Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: schpo-SPCC5E4.05C

Schizosaccharomyces pombe (Fission yeast) hypothetical 41.6 kda protein

Comment
Other strains: Schizosaccharomyces pombe (strain ATCC 38366 / 972)


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Schizosaccharomyces pombe
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > Taphrinomycotina: N E > Schizosaccharomycetes: N E > Schizosaccharomycetales: N E > Schizosaccharomycetaceae: N E > Schizosaccharomyces: N E > Schizosaccharomyces pombe: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AL033406, NC_003421, CU329672
1 UniProt : O94305
1 UniProt : O94305
1 Interpro : O94305
1 Prodom : O94305
1 Pfam : O94305
1 PIRSF : O94305
1 SUPERFAM : O94305
Sequence
Graphical view for this peptide sequence: schpo-SPCC5E4.05C
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MADLYTKDWTDVKDKPVARVVFIHGFGEHVNAYPEFFEALNERNIEVYTF
DQRGFGHSRKGGPKKQGCTGGWSLVFPDLDYQILRASDTELPLFLWGHSM
GGGLALRYGISGTHRHKLAGVIAQAPMLRCHPDTEPNFLLRKALTLVSKV
HPNFLFDSDVQSQHITRDEAVNQRLQDDPLVSSVGSLQVFSDMLNRGTKT
IELAPQFFLPLLITHGTDDNVTCSDSSKEFYENAGTKDKTYQSYPGFYHS
LHIEKKPEVYEYLDKVAAWIYEHSKPSETVKSEQE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MADLYTKDWTDVKDKPVARVVFIHGFGEHVNAYPEFFEALNERNIEVYTF
DQRGFGHSRKGGPKKQGCTGGWSLVFPDLDYQILRASDTELPLFLWGHSM
GGGLALRYGISGTHRHKLAGVIAQAPMLRCHPDTEPNFLLRKALTLVSKV
HPNFLFDSDVQSQHITRDEAVNQRLQDDPLVSSVGSLQVFSDMLNRGTKT
IELAPQFFLPLLITHGTDDNVTCSDSSKEFYENAGTKDKTYQSYPGFYHS
LHIEKKPEVYEYLDKVAAWIYEHSKPSETVKSEQE


References
    Title: Phosphoproteome analysis of fission yeast
    Wilson-Grady JT, Villen J, Gygi SP
    Ref: J Proteome Res, 7:1088, 2008 : PubMed

            

    Title: ORFeome cloning and global analysis of protein localization in the fission yeast Schizosaccharomyces pombe
    Matsuyama A, Arai R, Yashiroda Y, Shirai A, Kamata A, Sekido S, Kobayashi Y, Hashimoto A, Hamamoto M and Yoshida M <2 more author(s)>
    Ref: Nat Biotechnol, 24:841, 2006 : PubMed

            

    Title: The genome sequence of Schizosaccharomyces pombe
    Wood V, Gwilliam R, Rajandream MA, Lyne M, Lyne R, Stewart A, Sgouros J, Peat N, Hayles J and Nurse P <124 more author(s)>
    Ref: Nature, 415:871, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer