Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: schpo-yeld

Schizosaccharomyces pombe (Fission yeast) Uncharacterized membrane protein C6F6.13c

Comment
only central part Pfam A DUF726 351 692


Relationship
Family|Duf_726
Block| X
Position in NCBI Life Tree|Schizosaccharomyces pombe
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > Taphrinomycotina: N E > Schizosaccharomycetes: N E > Schizosaccharomycetales: N E > Schizosaccharomycetaceae: N E > Schizosaccharomyces: N E > Schizosaccharomyces pombe: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CU329670
1 UniProt : O14244
1 UniProt : O14244
1 Interpro : O14244
1 Prodom : O14244
1 Pfam : O14244
1 PIRSF : O14244
1 SUPERFAM : O14244
Sequence
Graphical view for this peptide sequence: schpo-yeld
Colored MSA for Duf_726 (raw)
IGGGLVIGLSSGLLAPIISAGIGAAFTTVGLSGVATSGFLAGGGSAALIT
AGGAISGAHIGTTGMAHRKADVKTFEFRPLHAQRRANVIVTVSGWMLSKE
DDVRLSFATLDPIVGDIYSVFWEPEMLASAGQTMNILATEVVTQSLQQVL
GSTVLVSLMGALQWPLILTKLGYLIDNPWNNSLDRAKATGQLLADMLCYR
SLGVRPVTLVGYSLGARVIYYCLRELEKKKEFSIIENVYLFGTPVIFKRT
SWLKAASVVSGRFVNGYKKNDWILGYLFRATSGGIGRVAGLRQIDCIPGI
ENIDVTNLVSGHLAYRESMPILLAAVGF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

IGGGLVIGLSSGLLAPIISAGIGAAFTTVGLSGVATSGFLAGGGSAALIT
AGGAISGAHIGTTGMAHRKADVKTFEFRPLHAQRRANVIVTVSGWMLSKE
DDVRLSFATLDPIVGDIYSVFWEPEMLASAGQTMNILATEVVTQSLQQVL
GSTVLVSLMGALQWPLILTKLGYLIDNPWNNSLDRAKATGQLLADMLCYR
SLGVRPVTLVGYSLGARVIYYCLRELEKKKEFSIIENVYLFGTPVIFKRT
SWLKAASVVSGRFVNGYKKNDWILGYLFRATSGGIGRVAGLRQIDCIPGI
ENIDVTNLVSGHLAYRESMPILLAAVGF


References
    Title: ORFeome cloning and global analysis of protein localization in the fission yeast Schizosaccharomyces pombe
    Matsuyama A, Arai R, Yashiroda Y, Shirai A, Kamata A, Sekido S, Kobayashi Y, Hashimoto A, Hamamoto M and Yoshida M <2 more author(s)>
    Ref: Nat Biotechnol, 24:841, 2006 : PubMed

            

    Title: The genome sequence of Schizosaccharomyces pombe
    Wood V, Gwilliam R, Rajandream MA, Lyne M, Lyne R, Stewart A, Sgouros J, Peat N, Hayles J and Nurse P <124 more author(s)>
    Ref: Nature, 415:871, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer