Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strag-GBS0040

Streptococcus agalactiae, hypothetical protein

Comment
Other strains: Streptococcus agalactiae (strains: ATCC 13813; H36B; 515; serotype Ia (strain ATCC 27591 / A909 / CDC SS700); serotype III (strain NEM316); serotype V (strain ATCC BAA-611 / 2603 V/R; COH1; CJB111; 18RS21)


Relationship
Family|Acetyl-esterase_deacetylase
Block| X
Position in NCBI Life Tree|Streptococcus agalactiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Streptococcus: N E > Streptococcus agalactiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: strag-GBS0040
Colored MSA for Acetyl-esterase_deacetylase (raw)
MIETMSLDDMREYLGQDQIPEDFDDFWKKQTMKYQGNIEYRLDKKDFNIT
FAQAYDLHFKGSNDSIVYAKCLFPKTNKPYPVVFYFHGYQNQSPDWSDQL
NYVAAGYGVVSMDVRGQAGQSQDKGHFDGITVKGQIVRGMISGPNHLFYK
DIYLDVFQLIDIIATLESVDSNQLYSYGWSQGGALALIAAALNPKIVKTV
AVYPFLSDFRRVLDLGGVSEPYDELFRYFKYSDPFHKTENSVLKTLAYID
VKNFAHRISCPVVLLTALKDDICPPSTQFAIFNRLTSTKKHLLLPDYGHD
PMTVQVKDYIFDQLTGSQFTKQKIE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIETMSLDDMREYLGQDQIPEDFDDFWKKQTMKYQGNIEYRLDKKDFNIT
FAQAYDLHFKGSNDSIVYAKCLFPKTNKPYPVVFYFHGYQNQSPDWSDQL
NYVAAGYGVVSMDVRGQAGQSQDKGHFDGITVKGQIVRGMISGPNHLFYK
DIYLDVFQLIDIIATLESVDSNQLYSYGWSQGGALALIAAALNPKIVKTV
AVYPFLSDFRRVLDLGGVSEPYDELFRYFKYSDPFHKTENSVLKTLAYID
VKNFAHRISCPVVLLTALKDDICPPSTQFAIFNRLTSTKKHLLLPDYGHD
PMTVQVKDYIFDQLTGSQFTKQKIE


References
    Title: Genome analysis of multiple pathogenic isolates of Streptococcus agalactiae: implications for the microbial pan-genome
    Tettelin H, Masignani V, Cieslewicz MJ, Donati C, Medini D, Ward NL, Angiuoli SV, Crabtree J, Jones AL and Fraser CM <36 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 102:13950, 2005 : PubMed

            

    Title: Genome sequence of Streptococcus agalactiae, a pathogen causing invasive neonatal disease
    Glaser P, Rusniok C, Buchrieser C, Chevalier F, Frangeul L, Msadek T, Zouine M, Couve E, Lalioui L and Kunst F <2 more author(s)>
    Ref: Molecular Microbiology, 45:1499, 2002 : PubMed

            

    Title: Complete genome sequence and comparative genomic analysis of an emerging human pathogen, serotype V Streptococcus agalactiae
    Tettelin H, Masignani V, Cieslewicz MJ, Eisen JA, Peterson S, Wessels MR, Paulsen IT, Nelson KE, Margarit I and Fraser CM <33 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:12391, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer