arath-CGEP

 
Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress); Capsella rubella, At2g47390/T8I13.23

Comment
long N-term extension as in xanax-XAC0805 xanca-XCC0753 xylfa-XF2551 arath-Q8VZF3 caucr-CC2671. Other strains: Arabidopsis lyrata subsp.; Capsella rubella


Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 2 more: AY064997, BT002650, AC002337
3 UniProt : Q8VZF3, D7LGM5, R0HRG5
3 UniProtTrembl : Q8VZF3, D7LGM5, R0HRG5
3 Interpro : Q8VZF3, D7LGM5, R0HRG5
3 Prodom : Q8VZF3, D7LGM5, R0HRG5
3 Pfam : Q8VZF3, D7LGM5, R0HRG5
3 PIRSF : Q8VZF3, D7LGM5, R0HRG5
3 SUPERFAM : Q8VZF3, D7LGM5, R0HRG5
3 QuickSwissBlast : Q8VZF3, D7LGM5, R0HRG5
1 Tair database : at2g47390
 
Sequence
Graphical view for this peptide sequence: arath-CGEP
Colored MSA for Glutamyl_Peptidase_S9 (raw)
MMRFHKACHRFSLSPLCHLSPPSPSPASSLLLLPKLSGFSTLSTRRCVRV
RRFSENPLTTVMASRSASRLRSLASACSGGAEDGGGTSNGSLSASATATE
DDELAIGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLA
DLARPEEKLAGVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGI
PDGGKINFVTWSNDGKHLAFSIRVDENGNSSKPVVWVADVETGVARPLFN
SQDIFLNAIFESFVWIDNSTLLVSTIPSSRGEPPKKPLVPSGPKTLSNET
KTVVQVRTFQDLLKDEYDADLFDYYASSQLVLASLDGTVKEVGVPAVYTS
LDPSTDHKYLLVSSLHRPYSFIVPCGRFPKKVEVWTTDGRFVRQLCDLPL
AEDIPIASNSVRKGMRSINWRADKPSTLWAETQDGGDAKMEVSPRDIVYM
QSAEPLAGEEPEVLHKLDLRYGGISWCDDTLALVYESWYKTRRTRTWVIS
PGSNDVSPRILFDRSSEDVYSDPGSTMLRRTDAGTYVIAKIKKENDEGTY
VLLNGSGATPQGNVPFLDLFDINTGNKERIWESDKEKYFETVVALMSDQK
EGDLKMEELKILTSKESKTENTQYSLQLWPDRKVQQITNFPHPYPQLASL
QKEMIRYQRKDGVQLTATLYLPPGYDPSKDGPLPYLFWSYPGEFKSKDAA
GQVRGSPNEFAGIGSTSALLWLARRFAILSGPTIPIIGEGDEEANDRYVE
QLVASAEAAVEEVVRRGVADRSKIAVGGHSYGAFMTANLLAHAPHLFACG
IARSGAYNRTLTPFGFQNEDRTLWEATNVYVEMSPFMSANKIKKPILLIH
GEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPHESHGYSARESIMHVL
WETDRWLQKYCVPNTSDADTSPDQSKEGSDSADKVSTGTGGGNPEFGEHE
VHSKLRRSLL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMRFHKACHRFSLSPLCHLSPPSPSPASSLLLLPKLSGFSTLSTRRCVRV
RRFSENPLTTVMASRSASRLRSLASACSGGAEDGGGTSNGSLSASATATE
DDELAIGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLA
DLARPEEKLAGVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPEKEITGI
PDGGKINFVTWSNDGKHLAFSIRVDENGNSSKPVVWVADVETGVARPLFN
SQDIFLNAIFESFVWIDNSTLLVSTIPSSRGEPPKKPLVPSGPKTLSNET
KTVVQVRTFQDLLKDEYDADLFDYYASSQLVLASLDGTVKEVGVPAVYTS
LDPSTDHKYLLVSSLHRPYSFIVPCGRFPKKVEVWTTDGRFVRQLCDLPL
AEDIPIASNSVRKGMRSINWRADKPSTLWAETQDGGDAKMEVSPRDIVYM
QSAEPLAGEEPEVLHKLDLRYGGISWCDDTLALVYESWYKTRRTRTWVIS
PGSNDVSPRILFDRSSEDVYSDPGSTMLRRTDAGTYVIAKIKKENDEGTY
VLLNGSGATPQGNVPFLDLFDINTGNKERIWESDKEKYFETVVALMSDQK
EGDLKMEELKILTSKESKTENTQYSLQLWPDRKVQQITNFPHPYPQLASL
QKEMIRYQRKDGVQLTATLYLPPGYDPSKDGPLPYLFWSYPGEFKSKDAA
GQVRGSPNEFAGIGSTSALLWLARRFAILSGPTIPIIGEGDEEANDRYVE
QLVASAEAAVEEVVRRGVADRSKIAVGGHSYGAFMTANLLAHAPHLFACG
IARSGAYNRTLTPFGFQNEDRTLWEATNVYVEMSPFMSANKIKKPILLIH
GEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPHESHGYSARESIMHVL
WETDRWLQKYCVPNTSDADTSPDQSKEGSDSADKVSTGTGGGNPEFGEHE
VHSKLRRSLL

no DNA




References
2 more
    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            

    Title: Empirical analysis of transcriptional activity in the Arabidopsis genome
    Yamada K, Lim J, Dale JM, Chen H, Shinn P, Palm CJ, Southwick AM, Wu HC, Kim C and Ecker JR <60 more author(s)>
    Ref: Science, 302:842, 2003 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer