Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bovin-thyro

Bos taurus (Bovine) Thyroglobulin

Comment
only c-term Pfam A COesterase 2190 2719 here only homologous region starting with first G in cholinesterase 2207


Relationship
Family|Thyroglobulin
Block| C
Position in NCBI Life Tree|Bos taurus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Ruminantia: N E > Pecora: N E > Bovidae: N E > Bovinae: N E > Bos: N E > Bos taurus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 7N4Y, 7QTQ
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: X02815, AAFC03041874, AAFC03064449
2 UniProt : P01267, A0A4W2CHS8
1 Ncbi-nid : 774
>3 Ncbi-pid links 1 more: 1109240A, 224619, NP_776308
2 Structure : 7QTQ, 7N4Y
3 UniProt : A0A4W2CHS8, P01267, F1MPH3
3 Interpro : A0A4W2CHS8, P01267, F1MPH3
3 Prodom : A0A4W2CHS8, P01267, F1MPH3
3 Pfam : A0A4W2CHS8, P01267, F1MPH3
3 PIRSF : A0A4W2CHS8, P01267, F1MPH3
3 SUPERFAM : A0A4W2CHS8, P01267, F1MPH3
Sequence
Graphical view for this peptide sequence: bovin-thyro
Colored MSA for Thyroglobulin (raw)
HGQLLGRSQAIQVGTSWKPVDQFLGVPYAAPPLGEKRFRAPEHLNWTGSW
EATKPRARCWQPGIRTPTPPGVSEDCLYLNVFVPQNMAPNASVLVFFHNA
AEGKGSGDRPAVDGSFLAAVGNLIVVTASYRTGIFGFLSSGSSELSGNWG
LLDQVVALTWVQTHIQAFGGDPRRVTLAADRGGADIASIHLVTTRAANSR
LFRRAVLMGGSALSPAAVIRPERARQQAAALAKEVGCPSSSVQEMVSCLR
QEPARILNDAQTKLLAVSGPFHYWGPVVDGQYLRETPARVLQRAPRVKVD
LLIGSSQDDGLINRAKAVKQFEESQGRTSSKTAFYQALQNSLGGEAADAG
VQAAATWYYSLEHDSDDYASFSRALEQATRDYFIICPVIDMASHWARTVR
GNVFMYHAPESYSHSSLELLTDVLYAFGLPFYPAYEGQFTLEEKSLSLKI
MQYFSNFIRSGNPNYPHEFSRRAPEFAAPWPDFVPRDGAESYKELSVLLP
NRQGLKKADCSFWSKYIQSLKASADETKDGPSADSEEEDQPAGSGLTEDL
LGLPELASKTYSK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

HGQLLGRSQAIQVGTSWKPVDQFLGVPYAAPPLGEKRFRAPEHLNWTGSW
EATKPRARCWQPGIRTPTPPGVSEDCLYLNVFVPQNMAPNASVLVFFHNA
AEGKGSGDRPAVDGSFLAAVGNLIVVTASYRTGIFGFLSSGSSELSGNWG
LLDQVVALTWVQTHIQAFGGDPRRVTLAADRGGADIASIHLVTTRAANSR
LFRRAVLMGGSALSPAAVIRPERARQQAAALAKEVGCPSSSVQEMVSCLR
QEPARILNDAQTKLLAVSGPFHYWGPVVDGQYLRETPARVLQRAPRVKVD
LLIGSSQDDGLINRAKAVKQFEESQGRTSSKTAFYQALQNSLGGEAADAG
VQAAATWYYSLEHDSDDYASFSRALEQATRDYFIICPVIDMASHWARTVR
GNVFMYHAPESYSHSSLELLTDVLYAFGLPFYPAYEGQFTLEEKSLSLKI
MQYFSNFIRSGNPNYPHEFSRRAPEFAAPWPDFVPRDGAESYKELSVLLP
NRQGLKKADCSFWSKYIQSLKASADETKDGPSADSEEEDQPAGSGLTEDL
LGLPELASKTYSK


References
6 more
    Title: Formation of thyroid hormone revealed by a cryo-EM structure of native bovine thyroglobulin
    Marechal N, Serrano BP, Zhang X, Weitz CJ
    Ref: Nat Commun, 13:2380, 2022 : PubMed

            

    Title: The structure of natively iodinated bovine thyroglobulin
    Kim K, Kopylov M, Bobe D, Kelley K, Eng ET, Arvan P, Clarke OB
    Ref: Acta Crystallographica D Struct Biol, 77:1451, 2021 : PubMed

            

    Title: Primary structure of bovine thyroglobulin deduced from the sequence of its 8,431-base complementary DNA
    Mercken L, Simons MJ, Swillens S, Massaer M, Vassart G
    Ref: Nature, 316:647, 1985 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer