Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: braol-a0a0d3dpb2

Brassica oleracea var. oleracea; Brassica napus (Rape); Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis). Uncharacterized protein

Comment
Other strains: Brassica oleracea var. oleracea; Brassica napus (Rape); Brassica rapa subsp. pekinensis (Chinese cabbage) (Brassica pekinensis)


Relationship
Family|UCP031088
Block| X
Position in NCBI Life Tree|Brassica oleracea var. oleracea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Brassiceae: N E > Brassica: N E > Brassica oleracea: N E > Brassica oleracea var. oleracea: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: braol-a0a0d3dpb2
Colored MSA for UCP031088 (raw)
MESLKRSKTSRTTPTFFISDLMATIPPQFPFEIRSALRRAASSTVYLLRP
IATVTPSLRHSTSKLLRPRAFSSSVKLPTKPPLCTADELHYVTVPNSDWR
LALWRYFPSPQAPTRNHPLLLLSGVGTNAIGYDLSPGCSFARHMSGEGYE
TWILEVRGAGLSTRVSDLKDVQDSAHELSRQIESTAKAAAKEAKATDVTD
SAPDVSVVGEASASAWDESKIVARLTATFMRLSERLSGFLSEGQSVFMSA
KLFDRIAMLLEDSRLYERFLEIRSKLLSLIESRQNSGLGNQIRELTQRLV
NLLDDGQRSVSPQLIDLQERLTSTIEDFQKQLDLIVKYDWDFDNYLEEDV
PAAIEYVRAQCKPKDGKLLAIGHSMGGILLYAMLSRCAFEGREPCLAAVA
TLASSLDYTTSDSALKLLIPLVDPAQALSVPVVPLGALLAAAYPLSSRPP
YVLSWLNDLISATDMMHPEQLEKLVLNNFCTIPAKLLIQLTTAFRAGGLR
DRSGKFYYKDHLSRTSVPVLALAGDRDLICPPAAVEDTAKLFPENLVTYK
VLGEPDGPHYAHYDLVGGRLAVEQVYPCITEFLSHHDSA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MESLKRSKTSRTTPTFFISDLMATIPPQFPFEIRSALRRAASSTVYLLRP
IATVTPSLRHSTSKLLRPRAFSSSVKLPTKPPLCTADELHYVTVPNSDWR
LALWRYFPSPQAPTRNHPLLLLSGVGTNAIGYDLSPGCSFARHMSGEGYE
TWILEVRGAGLSTRVSDLKDVQDSAHELSRQIESTAKAAAKEAKATDVTD
SAPDVSVVGEASASAWDESKIVARLTATFMRLSERLSGFLSEGQSVFMSA
KLFDRIAMLLEDSRLYERFLEIRSKLLSLIESRQNSGLGNQIRELTQRLV
NLLDDGQRSVSPQLIDLQERLTSTIEDFQKQLDLIVKYDWDFDNYLEEDV
PAAIEYVRAQCKPKDGKLLAIGHSMGGILLYAMLSRCAFEGREPCLAAVA
TLASSLDYTTSDSALKLLIPLVDPAQALSVPVVPLGALLAAAYPLSSRPP
YVLSWLNDLISATDMMHPEQLEKLVLNNFCTIPAKLLIQLTTAFRAGGLR
DRSGKFYYKDHLSRTSVPVLALAGDRDLICPPAAVEDTAKLFPENLVTYK
VLGEPDGPHYAHYDLVGGRLAVEQVYPCITEFLSHHDSA


References
    Title: Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome
    Chalhoub B, Denoeud F, Liu S, Parkin IA, Tang H, Wang X, Chiquet J, Belcram H, Tong C and Wincker P <70 more author(s)>
    Ref: Science, 345:950, 2014 : PubMed

            

    Title: Transcriptome and methylome profiling reveals relics of genome dominance in the mesopolyploid Brassica oleracea
    Parkin IA, Koh C, Tang H, Robinson SJ, Kagale S, Clarke WE, Town CD, Nixon J, Krishnakumar V and Sharpe AG <22 more author(s)>
    Ref: Genome Biol, 15:R77, 2014 : PubMed

            

    Title: The genome of the mesopolyploid crop species Brassica rapa
    Wang X, Wang H, Wang J, Sun R, Wu J, Liu S, Bai Y, Mun JH, Bancroft I and Zhang Z <88 more author(s)>
    Ref: Nat Genet, 43:1035, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer