Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: canal-ATG15

Candida albicans (Yeast), Candida tropicalis, Candida dubliniensis, putative lipase atg15 (EC 3.1.1.3) (autophagy-related protein 15)

Comment
Other strains: Candida albicans (Yeast), Candida tropicalis (strain ATCC MYA-3404 / T1), Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)


Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Candida albicans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Debaryomycetaceae: N E > Candida/Lodderomyces clade: N E > Candida [Debaryomycetaceae]: N E > Candida albicans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AL033391, AACQ01000064, AACQ01000065
3 UniProt : Q5A4N0, C5M8Y9, B9WIP0
3 UniProt : Q5A4N0, C5M8Y9, B9WIP0
3 Interpro : Q5A4N0, C5M8Y9, B9WIP0
3 Prodom : Q5A4N0, C5M8Y9, B9WIP0
3 Pfam : Q5A4N0, C5M8Y9, B9WIP0
3 PIRSF : Q5A4N0, C5M8Y9, B9WIP0
3 SUPERFAM : Q5A4N0, C5M8Y9, B9WIP0
Sequence
Graphical view for this peptide sequence: canal-ATG15
Colored MSA for Lipase_3 (raw)
MTLEKNRHANKGTSWTWMIYKFVVGVITVAILVLFITQKSVSQAQDKLRV
EQQAIFSDQDTLQLKHIFHHGTGPKNYRLHRRLDITSEYLAKHQPYFTTL
TQQLSKPVLEEHIASDNLDKIYQQSDWPEIHKGKNPFSIELPFKKADSEA
TRLKERNTPNFIESYLNYARDIKGDAQILNRINLDWIHDEIKVPNVTDRD
TVVTLATISSNAYVRYPKDDDEKRKSDWIDLGDWDPNREDDDVNFGWDDI
GLRGHVFVSKDNKTVVIGIKGTSGAGLPGGGSDETGGNDKTNDNLLFSCC
CARISYMWTTVCDCYEKTYTCNQDCLEKELRKEDKYYQAVLELYRNVTDI
YPPESTDIWVTGHSLGGALASLLGRTFGLPAVAFEAPGEMLATRRLHLPS
PPGLPQHMENIWHFGNTADPIYMGVCNGASSTCNLAGYAMETTCHTGLQC
VYDVVTDKGWSVNLLNHRIHTVIDDIILTYNETAPCAPSPPCRDCFNWRF
VAHDDNEKDEPKLPNPLRSSSKSTLSTKTTSLKSSSTYSGSTSSSTVTKT
TQTSPISSASPTDQDPPKKCLKRTWYGWCTKWGYYDDDDDEDTFERK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTLEKNRHANKGTSWTWMIYKFVVGVITVAILVLFITQKSVSQAQDKLRV
EQQAIFSDQDTLQLKHIFHHGTGPKNYRLHRRLDITSEYLAKHQPYFTTL
TQQLSKPVLEEHIASDNLDKIYQQSDWPEIHKGKNPFSIELPFKKADSEA
TRLKERNTPNFIESYLNYARDIKGDAQILNRINLDWIHDEIKVPNVTDRD
TVVTLATISSNAYVRYPKDDDEKRKSDWIDLGDWDPNREDDDVNFGWDDI
GLRGHVFVSKDNKTVVIGIKGTSGAGLPGGGSDETGGNDKTNDNLLFSCC
CARISYMWTTVCDCYEKTYTCNQDCLEKELRKEDKYYQAVLELYRNVTDI
YPPESTDIWVTGHSLGGALASLLGRTFGLPAVAFEAPGEMLATRRLHLPS
PPGLPQHMENIWHFGNTADPIYMGVCNGASSTCNLAGYAMETTCHTGLQC
VYDVVTDKGWSVNLLNHRIHTVIDDIILTYNETAPCAPSPPCRDCFNWRF
VAHDDNEKDEPKLPNPLRSSSKSTLSTKTTSLKSSSTYSGSTSSSTVTKT
TQTSPISSASPTDQDPPKKCLKRTWYGWCTKWGYYDDDDDEDTFERK


References
1 more
    Title: Evolution of pathogenicity and sexual reproduction in eight Candida genomes
    Butler G, Rasmussen MD, Lin MF, Santos MA, Sakthikumar S, Munro CA, Rheinbay E, Grabherr M, Forche A and Cuomo CA <41 more author(s)>
    Ref: Nature, 459:657, 2009 : PubMed

            

    Title: The diploid genome sequence of Candida albicans
    Jones T, Federspiel NA, Chibana H, Dungan J, Kalman S, Magee BB, Newport G, Thorstenson YR, Agabian N and Scherer S <2 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:7329, 2004 : PubMed

            

    Title: A Candida albicans genome project: cosmid contigs, physical mapping, and gene isolation
    Tait E, Simon MC, King S, Brown AJ, Gow NA, Shaw DJ
    Ref: Fungal Genet Biol, 21:308, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer