Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lismo-LMO2450

Listeria monocytogenes hypothetical protein lmo2450

Comment
Other strains: Listeria monocytogenes (and serotype 4a (strain HCC23); serotype 4b (strain Clip81459; H7858; F2365); FSL N3-165; FSL R2-503; J2818; F6900; serotype 1/2a (strain 08-5578; 08-5923; F6854))


Relationship
Family|CarbLipBact_1
Block| X
Position in NCBI Life Tree|Listeria monocytogenes
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Listeriaceae: N E > Listeria: N E > Listeria monocytogenes: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: lismo-LMO2450
Colored MSA for CarbLipBact_1 (raw)
MKITPPQPFLFEKGKRAVLLLHGFTGSSADVRILGRFLQENNYTCYAPQY
RGHGVSPDLLLKTGPNDWWEDVLEAYDHLKSLGYTEIAVAGLSLGGLFSL
KLGFSRPLKGIIAMSTPTRMDSSSPIIQGFLDYVRNYKKLEGKTTEQIDA
EMVAYKDAPMNTIAKLKDEISGVVAEIDMIYAPIMVVQGEKDDMVDVSGA
QLIYDTVESTKKELHWFKESGHVITLDKERKEVNQAILTFLDSLDWQE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKITPPQPFLFEKGKRAVLLLHGFTGSSADVRILGRFLQENNYTCYAPQY
RGHGVSPDLLLKTGPNDWWEDVLEAYDHLKSLGYTEIAVAGLSLGGLFSL
KLGFSRPLKGIIAMSTPTRMDSSSPIIQGFLDYVRNYKKLEGKTTEQIDA
EMVAYKDAPMNTIAKLKDEISGVVAEIDMIYAPIMVVQGEKDDMVDVSGA
QLIYDTVESTKKELHWFKESGHVITLDKERKEVNQAILTFLDSLDWQE


References
1 more
    Title: High-throughput genome sequencing of two Listeria monocytogenes clinical isolates during a large foodborne outbreak
    Gilmour MW, Graham M, Van Domselaar G, Tyler S, Kent H, Trout-Yakel KM, Larios O, Allen V, Lee B, Nadon C
    Ref: BMC Genomics, 11:120, 2010 : PubMed

            

    Title: Whole genome comparisons of serotype 4b and 1/2a strains of the food-borne pathogen Listeria monocytogenes reveal new insights into the core genome components of this species
    Nelson KE, Fouts DE, Mongodin EF, Ravel J, DeBoy RT, Kolonay JF, Rasko DA, Angiuoli SV, Gill SR and Fraser CM <23 more author(s)>
    Ref: Nucleic Acids Research, 32:2386, 2004 : PubMed

            

    Title: Comparative genomics of Listeria species
    Glaser P, Frangeul L, Buchrieser C, Rusniok C, Amend A, Baquero F, Berche P, Bloecker H, Brandt P and Cossart P <45 more author(s)>
    Ref: Science, 294:849, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer