mouse-Q8C167

 
Mus musculus (Mouse) PERLP unknown (protein for mgc:7980) mkiaa0436

Relationship
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: BC004612, AK050878, AK028877
1 UniProt : Q8C167
2 UniProtTrembl : Q8BKS6, Q8C167
2 Interpro : Q8BKS6, Q8C167
2 Prodom : Q8BKS6, Q8C167
2 Pfam : Q8BKS6, Q8C167
2 PIRSF : Q8BKS6, Q8C167
2 SUPERFAM : Q8BKS6, Q8C167
2 QuickSwissBlast : Q8BKS6, Q8C167
2 ENSEMBL : Q99KJ9, ENSMUSG00000024127
 
Sequence
Graphical view for this peptide sequence: mouse-Q8C167
Colored MSA for S9N_PREPL_Peptidase_S9 (raw)
MDAFEKVRTRLETQPQEEYEVVNAEIKHGGFVYYQEGCCLVRSKDEEADS
DNYEVLFNLEELKLDQPFIDCIRVAPDEKYVAAKIRTEDSETSTLVVVKL
SDQPVMEASFPNVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDNK
RNERFYTEKDPSYFVFLYLTKDSRFLTLNIMNKTTSEVWLIDGLSPWDPP
VLIQKRIHGMLYYVEHRDDELYILTNVGEPTEFKLMRTAADAPAIMNWDL
FFTMKRNTKVVDLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLKLPPW
ACGFIMDTNSDPKNCPFQLCSPIRPPKYYTYKFAEGKLFEETGHEDPITK
TSRVLRIEAKSKDGKLVPMTVFHKTDSEDLQRKPLLVHVYGAYGMDLKMN
FRPEKRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLVACI
KTLHSQGFSQPSLTTLSAFSAGGVLVGALCNSKPELLRAVTLEAPFLDVL
NTMLDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPCQNIKPQHYPSVHI
TAYENDERVPLKGIVNYTEKLKEAVAEHTKGAGEGYQPPNIILDIQPGGN
HVIEDSHKKITTQMKFLYEELGLDSTDAFEALKKYLKF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDAFEKVRTRLETQPQEEYEVVNAEIKHGGFVYYQEGCCLVRSKDEEADS
DNYEVLFNLEELKLDQPFIDCIRVAPDEKYVAAKIRTEDSETSTLVVVKL
SDQPVMEASFPNVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDNK
RNERFYTEKDPSYFVFLYLTKDSRFLTLNIMNKTTSEVWLIDGLSPWDPP
VLIQKRIHGMLYYVEHRDDELYILTNVGEPTEFKLMRTAADAPAIMNWDL
FFTMKRNTKVVDLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLKLPPW
ACGFIMDTNSDPKNCPFQLCSPIRPPKYYTYKFAEGKLFEETGHEDPITK
TSRVLRIEAKSKDGKLVPMTVFHKTDSEDLQRKPLLVHVYGAYGMDLKMN
FRPEKRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLVACI
KTLHSQGFSQPSLTTLSAFSAGGVLVGALCNSKPELLRAVTLEAPFLDVL
NTMLDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPCQNIKPQHYPSVHI
TAYENDERVPLKGIVNYTEKLKEAVAEHTKGAGEGYQPPNIILDIQPGGN
HVIEDSHKKITTQMKFLYEELGLDSTDAFEALKKYLKF

no DNA




Reference
    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer