mouse-3neur

Mus musculus (Mouse) partial mRNA for neuroligin 3 protein

Comment

"on chromosome X ENSMUSG00000031302" || "Q8BYM5 from Okazaki some diff" || "Neuroligins constitute a family of proteins thought to mediate cell-to-cell interactions between neurons. Neuroligins function as ligands for the neurexin family of cell surface receptors. Homo sapiens KIAA1480 . More recently it was cloned by Philibert et al. with some aa differences and with two alternative forms HNL3 HNLS3S. ChrX q21.1. In 2 brothers with autism, one with typical autism and the other with Asperger syndrome, Jamain et al. (2003) identified a mutation R451C in the human-NLGN3 gene. arg451 in NLGN3, arg386 in BCHE, and arg395 in ACHE are conserved in mammalian species. In cellular transfection studies, De Jaco et al. (2006) inserted mutations homologous to the NLGN3 R451C mutation in BCHE and ACHE cDNAs and found that these mutations resulted in endoplasmic reticulum retention of the 2 proteins, similar to that observed with the NLGN3 R451C mutant protein. Tabuchi et al. (2007) introduced the R451C substitution in neuroligin-3 into mice. R451C mutant mice showed impaired social interactions but enhanced spatial learning abilities. Unexpectedly these behavioral changes were accompanied by an increase in inhibitory synaptic transmission with no apparent effect on excitatory synapses. Deletion of neuroligin-3, in contrast, did not cause such changes, indicating that the R451C substitution represents a gain-of-function mutation. Tabuchi et al. (2007) concluded that increased inhibitory synaptic transmission may contribute to human autism spectrum disorders and that the R451C knockin mice may be a useful model for studying autism-related behaviors. Recently Venkatesh et al. showed that neuronal activity promotes glioma growth through Neuroligin-3 secretion"

Relationship

Family : Neuroligin

Block : C

Position in NCBI Life Tree : Mus musculus

Molecular evidence

No mutation

No kinetic

No disease

No substrate

No inhibitor

Sequence

Peptide

GSSQCGHEGAAYWADAVTPESSSPASPPARNMWLQPSLSL
SPTPTVGRSL CLTLGFLSLVLRASTQAPAPTVNTHFGKL
RGARVPLPSEILGPVDQYLGV PYAAPPIGEKRFLPPEPP
PSWSGIRNATHFPPVCPQNIHTAVPEVMLPVW FTANLDI
VATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKIC
RKG GSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHG
GSYMEGTGNMIDGS VLASYGNVIVITLNYRVGVLGFLST
GDQAAKGNYGLLDQIQALRWVSENI AFFGGDPRRITVFG
SGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWA VNY
QPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKELVEQDI
QPARYHV AFGPVIDGDVIPDDPEILMEQGEFLNYDIMLG
VNQGEGLKFVEGVVDPED GVSGTDFDYSVSNFVDNLYGY
PEGKDTLRETIKFMYTDWADRDNPETRRK TLVALFTDHQ
WVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSDAA
HGDEVPYVFGVPMVGPTDLFPCNFSKNDVMLSAVVMTYW
TNFAKTGDPNK PVPQDTKFIHTKANRFEEVAWSKYNPRD
QLYLHIGLKPRVRDHYRATKVA FWKHLVPHLYNLHDMFH
YTSTTTKVPPPDTTHSSHITRRPNGKTWSTKRP AISPAY
SNENAPGSWNGDQDAGPLLVENPRDYSTELSVTIAVGASL
LFLN VLAFAALYYRKDKRRQEPLRQPSPQRGTGAPELGT
APEEELAALQLGPTH HECEAGPPHDTLRLTALPDYTLTL
RRSPDDIPLMTPNTITMIPNSLVGLQ TLHPYNTFAAGFN
STGLPHSHSTTRV

References

Title : Faster Gastrointestinal Transit, Reduced Small Intestinal Smooth Muscle Tone and Dysmotility in the Nlgn3(R451C) Mouse Model of Autism - Hosie_2024_Int.J.Mol.Sci_25_
Author(s) : Hosie S , Abo-Shaban T , Mou K , Balasuriya GK , Mohsenipour M , Alamoudi MU , Filippone RT , Belz GT , Franks AE , Bornstein JC , Nurgali K , Hill-Yardin EL
Ref : Int J Mol Sci , 25 : , 2024
Abstract : Hosie_2024_Int.J.Mol.Sci_25_
ESTHER : Hosie_2024_Int.J.Mol.Sci_25_
PubMedSearch : Hosie_2024_Int.J.Mol.Sci_25_
PubMedID: 38255906
Gene_locus related to this paper: mouse-3neur

Title : Glucocorticoids rescue cell surface trafficking of R451C Neuroligin3 and enhance synapse formation - Diamanti_2024_Traffic_25_e12930
Author(s) : Diamanti T , Trobiani L , Mautone L , Serafini F , Gioia R , Ferrucci L , Lauro C , Bianchi S , Perfetto C , Guglielmo S , Sollazzo R , Giorda E , Setini A , Ragozzino D , Miranda E , Comoletti D , Di Angelantonio S , Cacci E , De Jaco A
Ref : Traffic , 25 :e12930 , 2024
Abstract : Diamanti_2024_Traffic_25_e12930
ESTHER : Diamanti_2024_Traffic_25_e12930
PubMedSearch : Diamanti_2024_Traffic_25_e12930
PubMedID: 38272450
Gene_locus related to this paper: human-NLGN3 , mouse-3neur

Title : Mice with an autism-associated R451C mutation in neuroligin-3 show intact attention orienting but atypical responses to methylphenidate and atomoxetine in the mouse-Posner task - Li_2024_Psychopharmacology.(Berl)__
Author(s) : Li S , May C , Pang TY , Churilov L , Hannan AJ , Johnson KA , Burrows EL
Ref : Psychopharmacology (Berl) , : , 2024
Abstract : Li_2024_Psychopharmacology.(Berl)__
ESTHER : Li_2024_Psychopharmacology.(Berl)__
PubMedSearch : Li_2024_Psychopharmacology.(Berl)__
PubMedID: 38170320
Gene_locus related to this paper: human-NLGN3 , mouse-3neur

Title : Insulin-like growth factor 2 (IGF-2) rescues social deficits in NLG3(-\/y) mouse model of ASDs - Pizzarelli_2024_Front.Cell.Neurosci_17_1332179
Author(s) : Pizzarelli R , Pimpinella D , Jacobs C , Tartacca A , Kullolli U , Monyer H , Alberini CM , Griguoli M
Ref : Front Cell Neurosci , 17 :1332179 , 2024
Abstract : Pizzarelli_2024_Front.Cell.Neurosci_17_1332179
ESTHER : Pizzarelli_2024_Front.Cell.Neurosci_17_1332179
PubMedSearch : Pizzarelli_2024_Front.Cell.Neurosci_17_1332179
PubMedID: 38298376
Gene_locus related to this paper: human-NLGN3 , mouse-3neur

Title : Impaired cecal motility and secretion alongside expansion of gut-associated lymphoid tissue in the Nlgn3(R451C) mouse model of autism - Lee_2023_Sci.Rep_13_12687
Author(s) : Lee CYQ , Balasuriya GK , Herath M , Franks AE , Hill-Yardin EL
Ref : Sci Rep , 13 :12687 , 2023
Abstract : Lee_2023_Sci.Rep_13_12687
ESTHER : Lee_2023_Sci.Rep_13_12687
PubMedSearch : Lee_2023_Sci.Rep_13_12687
PubMedID: 37542090
Gene_locus related to this paper: mouse-3neur

Title : Region-Specific Phosphorylation Determines Neuroligin-3 Localization to Excitatory versus Inhibitory Synapses - Altas_2023_Biol.Psychiatry__
Author(s) : Altas B , Tuffy LP , Patrizi A , Dimova K , Soykan T , Brandenburg C , Romanowski AJ , Whitten JR , Robertson CD , Khim SN , Crutcher GW , Ambrozkiewicz MC , Yagensky O , Krueger-Burg D , Hammer M , Hsiao HH , Laskowski PR , Dyck L , Puche AC , Sassoe-Pognetto M , Chua JJE , Urlaub H , Jahn O , Brose N , Poulopoulos A
Ref : Biological Psychiatryry , : , 2023
Abstract : Altas_2023_Biol.Psychiatry__
ESTHER : Altas_2023_Biol.Psychiatry__
PubMedSearch : Altas_2023_Biol.Psychiatry__
PubMedID: 38154503
Gene_locus related to this paper: human-NLGN3 , mouse-3neur

Title : Canonical versus non-canonical transsynaptic signaling of neuroligin 3 tunes development of sociality in mice - Yoshida_2021_Nat.Commun_12_1848
Author(s) : Yoshida T , Yamagata A , Imai A , Kim J , Izumi H , Nakashima S , Shiroshima T , Maeda A , Iwasawa-Okamoto S , Azechi K , Osaka F , Saitoh T , Maenaka K , Shimada T , Fukata Y , Fukata M , Matsumoto J , Nishijo H , Takao K , Tanaka S , Okabe S , Tabuchi K , Uemura T , Mishina M , Mori H , Fukai S
Ref : Nat Commun , 12 :1848 , 2021
Abstract : Yoshida_2021_Nat.Commun_12_1848
ESTHER : Yoshida_2021_Nat.Commun_12_1848
PubMedSearch : Yoshida_2021_Nat.Commun_12_1848
PubMedID: 33758193
Gene_locus related to this paper: mouse-3neur

Title : Mutations in neuroligin-3 in male mice impact behavioral flexibility but not relational memory in a touchscreen test of visual transitive inference - Norris_2019_Mol.Autism_10_42
Author(s) : Norris RHC , Churilov L , Hannan AJ , Nithianantharajah J
Ref : Mol Autism , 10 :42 , 2019
Abstract : Norris_2019_Mol.Autism_10_42
ESTHER : Norris_2019_Mol.Autism_10_42
PubMedSearch : Norris_2019_Mol.Autism_10_42
PubMedID: 31827744
Gene_locus related to this paper: mouse-3neur , human-NLGN3

Title : Gastrointestinal dysfunction in patients and mice expressing the autism-associated R451C mutation in neuroligin-3 - Hosie_2019_Autism.Res_12_1043
Author(s) : Hosie S , Ellis M , Swaminathan M , Ramalhosa F , Seger GO , Balasuriya GK , Gillberg C , Rastam M , Churilov L , McKeown SJ , Yalcinkaya N , Urvil P , Savidge T , Bell CA , Bodin O , Wood J , Franks AE , Bornstein JC , Hill-Yardin EL
Ref : Autism Res , 12 :1043 , 2019
Abstract : Hosie_2019_Autism.Res_12_1043
ESTHER : Hosie_2019_Autism.Res_12_1043
PubMedSearch : Hosie_2019_Autism.Res_12_1043
PubMedID: 31119867
Gene_locus related to this paper: mouse-3neur , human-NLGN3

Title : Genetic background effects in Neuroligin-3 mutant mice: Minimal behavioral abnormalities on C57 background - Jaramillo_2018_Autism.Res_11_234
Author(s) : Jaramillo TC , Escamilla CO , Liu S , Peca L , Birnbaum SG , Powell CM
Ref : Autism Res , 11 :234 , 2018
Abstract : Jaramillo_2018_Autism.Res_11_234
ESTHER : Jaramillo_2018_Autism.Res_11_234
PubMedSearch : Jaramillo_2018_Autism.Res_11_234
PubMedID: 29028156
Gene_locus related to this paper: mouse-3neur

Title : Altered Amygdala Excitation and CB1 Receptor Modulation of Aggressive Behavior in the Neuroligin-3(R451C) Mouse Model of Autism - Hosie_2018_Front.Cell.Neurosci_12_234
Author(s) : Hosie S , Malone DT , Liu S , Glass M , Adlard PA , Hannan AJ , Hill-Yardin EL
Ref : Front Cell Neurosci , 12 :234 , 2018
Abstract : Hosie_2018_Front.Cell.Neurosci_12_234
ESTHER : Hosie_2018_Front.Cell.Neurosci_12_234
PubMedSearch : Hosie_2018_Front.Cell.Neurosci_12_234
PubMedID: 30123111
Gene_locus related to this paper: mouse-3neur

Title : The neurobiological bases of autism spectrum disorders: the R451C-neuroligin 3 mutation hampers the expression of long-term synaptic depression in the dorsal striatum - Martella_2018_Eur.J.Neurosci_47_701
Author(s) : Martella G , Meringolo M , Trobiani L , De Jaco A , Pisani A , Bonsi P
Ref : European Journal of Neuroscience , 47 :701 , 2018
Abstract : Martella_2018_Eur.J.Neurosci_47_701
ESTHER : Martella_2018_Eur.J.Neurosci_47_701
PubMedSearch : Martella_2018_Eur.J.Neurosci_47_701
PubMedID: 28921757
Gene_locus related to this paper: mouse-3neur , human-NLGN3

Title : Gamma Oscillation Dysfunction in mPFC Leads to Social Deficits in Neuroligin 3 R451C Knockin Mice - Cao_2018_Neuron_97_1253
Author(s) : Cao W , Lin S , Xia QQ , Du YL , Yang Q , Zhang MY , Lu YQ , Xu J , Duan SM , Xia J , Feng G , Luo JH
Ref : Neuron , 97 :1253 , 2018
Abstract : Cao_2018_Neuron_97_1253
ESTHER : Cao_2018_Neuron_97_1253
PubMedSearch : Cao_2018_Neuron_97_1253
PubMedID: 29503190
Gene_locus related to this paper: mouse-3neur

Title : Social Isolation Alters Social and Mating Behavior in the R451C Neuroligin Mouse Model of Autism - Burrows_2017_Neural.Plast_2017_8361290
Author(s) : Burrows EL , Eastwood AF , May C , Kolbe SC , Hill T , McLachlan NM , Churilov L , Hannan AJ
Ref : Neural Plast , 2017 :8361290 , 2017
Abstract : Burrows_2017_Neural.Plast_2017_8361290
ESTHER : Burrows_2017_Neural.Plast_2017_8361290
PubMedSearch : Burrows_2017_Neural.Plast_2017_8361290
PubMedID: 28255463
Gene_locus related to this paper: mouse-3neur

Title : A neuroligin-3 mutation implicated in autism causes abnormal aggression and increases repetitive behavior in mice - Burrows_2015_Mol.Autism_6_62
Author(s) : Burrows EL , Laskaris L , Koyama L , Churilov L , Bornstein JC , Hill-Yardin EL , Hannan AJ
Ref : Mol Autism , 6 :62 , 2015
Abstract : Burrows_2015_Mol.Autism_6_62
ESTHER : Burrows_2015_Mol.Autism_6_62
PubMedSearch : Burrows_2015_Mol.Autism_6_62
PubMedID: 26583067
Gene_locus related to this paper: mouse-3neur

Title : Reduced susceptibility to induced seizures in the Neuroligin-3(R451C) mouse model of autism - Hill-Yardin_2015_Neurosci.Lett_589_57
Author(s) : Hill-Yardin EL , Argyropoulos A , Hosie S , Rind G , Anderson P , Hannan AJ , O'Brien TJ
Ref : Neuroscience Letters , 589 :57 , 2015
Abstract : Hill-Yardin_2015_Neurosci.Lett_589_57
ESTHER : Hill-Yardin_2015_Neurosci.Lett_589_57
PubMedSearch : Hill-Yardin_2015_Neurosci.Lett_589_57
PubMedID: 25592157
Gene_locus related to this paper: mouse-3neur

Title : Autism-related neuroligin-3 mutation alters social behavior and spatial learning - Jaramillo_2014_Autism.Res_7_264
Author(s) : Jaramillo TC , Liu S , Pettersen A , Birnbaum SG , Powell CM
Ref : Autism Res , 7 :264 , 2014
Abstract : Jaramillo_2014_Autism.Res_7_264
ESTHER : Jaramillo_2014_Autism.Res_7_264
PubMedSearch : Jaramillo_2014_Autism.Res_7_264
PubMedID: 24619977
Gene_locus related to this paper: mouse-3neur

Title : Minimal aberrant behavioral phenotypes of neuroligin-3 R451C knockin mice - Chadman_2008_Autism.Res_1_147
Author(s) : Chadman KK , Gong S , Scattoni ML , Boltuck SE , Gandhy SU , Heintz N , Crawley JN
Ref : Autism Res , 1 :147 , 2008
Abstract : Chadman_2008_Autism.Res_1_147
ESTHER : Chadman_2008_Autism.Res_1_147
PubMedSearch : Chadman_2008_Autism.Res_1_147
PubMedID: 19360662
Gene_locus related to this paper: mouse-3neur

Title : Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs - Okazaki_2002_Nature_420_563
Author(s) : Okazaki Y , Furuno M , Kasukawa T , Adachi J , Bono H , Kondo S , Nikaido I , Osato N , Saito R , Suzuki H , Yamanaka I , Kiyosawa H , Yagi K , Tomaru Y , Hasegawa Y , Nogami A , Schonbach C , Gojobori T , Baldarelli R , Hill DP , Bult C , Hume DA , Quackenbush J , Schriml LM , Kanapin A , Matsuda H , Batalov S , Beisel KW , Blake JA , Bradt D , Brusic V , Chothia C , Corbani LE , Cousins S , Dalla E , Dragani TA , Fletcher CF , Forrest A , Frazer KS , Gaasterland T , Gariboldi M , Gissi C , Godzik A , Gough J , Grimmond S , Gustincich S , Hirokawa N , Jackson IJ , Jarvis ED , Kanai A , Kawaji H , Kawasawa Y , Kedzierski RM , King BL , Konagaya A , Kurochkin IV , Lee Y , Lenhard B , Lyons PA , Maglott DR , Maltais L , Marchionni L , McKenzie L , Miki H , Nagashima T , Numata K , Okido T , Pavan WJ , Pertea G , Pesole G , Petrovsky N , Pillai R , Pontius JU , Qi D , Ramachandran S , Ravasi T , Reed JC , Reed DJ , Reid J , Ring BZ , Ringwald M , Sandelin A , Schneider C , Semple CA , Setou M , Shimada K , Sultana R , Takenaka Y , Taylor MS , Teasdale RD , Tomita M , Verardo R , Wagner L , Wahlestedt C , Wang Y , Watanabe Y , Wells C , Wilming LG , Wynshaw-Boris A , Yanagisawa M , Yang I , Yang L , Yuan Z , Zavolan M , Zhu Y , Zimmer A , Carninci P , Hayatsu N , Hirozane-Kishikawa T , Konno H , Nakamura M , Sakazume N , Sato K , Shiraki T , Waki K , Kawai J , Aizawa K , Arakawa T , Fukuda S , Hara A , Hashizume W , Imotani K , Ishii Y , Itoh M , Kagawa I , Miyazaki A , Sakai K , Sasaki D , Shibata K , Shinagawa A , Yasunishi A , Yoshino M , Waterston R , Lander ES , Rogers J , Birney E , Hayashizaki Y
Ref : Nature , 420 :563 , 2002
Abstract : Okazaki_2002_Nature_420_563
ESTHER : Okazaki_2002_Nature_420_563
PubMedSearch : Okazaki_2002_Nature_420_563
PubMedID: 12466851
Gene_locus related to this paper: mouse-1lipg , mouse-1llip , mouse-1plrp , mouse-3neur , mouse-ABH15 , mouse-abhd4 , mouse-abhd5 , mouse-Abhd8 , mouse-Abhd11 , mouse-abhda , mouse-acot4 , mouse-adcl4 , mouse-AI607300 , mouse-BAAT , mouse-bphl , mouse-C87498 , mouse-Ldah , mouse-Ces1d , mouse-Ces2e , mouse-CMBL , mouse-DGLB , mouse-dpp9 , mouse-ES10 , mouse-F135A , mouse-FASN , mouse-hslip , mouse-hyes , mouse-Kansl3 , mouse-LIPH , mouse-LIPK , mouse-lipli , mouse-LIPM , mouse-lypla1 , mouse-lypla2 , mouse-MEST , mouse-MGLL , mouse-ndr4 , mouse-OVCA2 , mouse-pafa , mouse-pcp , mouse-ppce , mouse-Ppgb , mouse-PPME1 , mouse-q3uuq7 , mouse-Q8BLF1 , mouse-ACOT6 , mouse-Q8C1A9 , mouse-Q9DAI6 , mouse-Q80UX8 , mouse-Q8BGG9 , mouse-Q8C167 , mouse-rbbp9 , mouse-SERHL , mouse-tssp

Title : Neuroligin 3 is a vertebrate gliotactin expressed in the olfactory ensheathing glia, a growth-promoting class of macroglia - Gilbert_2001_Glia_34_151
Author(s) : Gilbert M , Smith J , Roskams AJ , Auld VJ
Ref : Glia , 34 :151 , 2001
Abstract : Gilbert_2001_Glia_34_151
ESTHER : Gilbert_2001_Glia_34_151
PubMedSearch : Gilbert_2001_Glia_34_151
PubMedID: 11329178
Gene_locus related to this paper: mouse-3neur , ratno-1neur , ratno-2neur , ratno-3neur