Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-notum

Mus musculus (Mouse) Protein notum homolog

Comment
In animals Notum acts to modify heparan sulfate proteoglycans and thereby alters the extracellular gradient of Wg/Wnt protein


Relationship
Family|Pectinacetylesterase-Notum
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
3 inhibitors: LP-914822, LP-922056, LP-935001
2 Genbank : AL663030, BC025832
2 UniProt : Q8R116, B7ZCA6
2 UniProt : Q8R116, B7ZCA6
2 Interpro : Q8R116, B7ZCA6
2 Pfam : Q8R116, B7ZCA6
2 PIRSF : Q8R116, B7ZCA6
2 SUPERFAM : Q8R116, B7ZCA6
1 MGD : 1924833
1 ENSEMBL : ENSMUSG00000042988
Sequence
Graphical view for this peptide sequence: mouse-notum
Colored MSA for Pectinacetylesterase-Notum (raw)
MGGEVRVLLLLGLLHWVGGSEGRKTWRRRGQQPPQPPPPPPLPQRAEVEP
GAGQPVESFPLDFTAVEGNMDSFMAQVKSLAQSLYPCSAQQLNEDLRLHL
LLNTSVTCNDGSPAGYYLKESKGSRRWLLFLEGGWYCFNRENCDSRYSTM
RRLMSSKDWPHTRTGTGILSSQPEENPHWWNANMVFIPYCSSDVWSGASP
KSDKNEYAFMGSLIIQEVVRELLGKGLSGAKVLLLAGSSAGGTGVLLNVD
RVAELLEELGYPSIQVRGLADSGWFLDNKQYRRSDCIDTINCAPTDAIRR
GIRYWSGMVPERCQRQFKEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQ
LTVDNVHLTGQPVQEGQWLYIQNLGRELRGTLKDVQASFAPACLSHEIII
RSYWTDVQVKGTSLPRALHCWDRSFHDSHKASKTPMKGCPFHLVDSCPWP
HCNPSCPTIRDQFTGQEMNVAQFLMHMGFDVQTVAQQQGMEPSKLLGMLS
NGN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGGEVRVLLLLGLLHWVGGSEGRKTWRRRGQQPPQPPPPPPLPQRAEVEP
GAGQPVESFPLDFTAVEGNMDSFMAQVKSLAQSLYPCSAQQLNEDLRLHL
LLNTSVTCNDGSPAGYYLKESKGSRRWLLFLEGGWYCFNRENCDSRYSTM
RRLMSSKDWPHTRTGTGILSSQPEENPHWWNANMVFIPYCSSDVWSGASP
KSDKNEYAFMGSLIIQEVVRELLGKGLSGAKVLLLAGSSAGGTGVLLNVD
RVAELLEELGYPSIQVRGLADSGWFLDNKQYRRSDCIDTINCAPTDAIRR
GIRYWSGMVPERCQRQFKEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQ
LTVDNVHLTGQPVQEGQWLYIQNLGRELRGTLKDVQASFAPACLSHEIII
RSYWTDVQVKGTSLPRALHCWDRSFHDSHKASKTPMKGCPFHLVDSCPWP
HCNPSCPTIRDQFTGQEMNVAQFLMHMGFDVQTVAQQQGMEPSKLLGMLS
NGN


References
4 more
    Title: Notum deletion from late-stage skeletal cells increases cortical bone formation and potentiates skeletal effects of sclerostin inhibition
    Choi RB, Bullock WA, Hoggatt AM, Horan DJ, Pemberton EZ, Hong JM, Zhang X, He X, Robling AG
    Ref: J Bone Miner Res, :, 2021 : PubMed

            

    Title: Osteocyte- and late Osteoblast-derived NOTUM Reduces Cortical Bone Mass in Mice
    Nilsson KH, Henning P, El Shahawy M, Wu J, Koskela A, Tuukkanen J, Perret C, Lerner UH, Ohlsson C, Moverare-Skrtic S
    Ref: American Journal of Physiology Endocrinol Metab, :, 2021 : PubMed

            

    Title: Notum produced by Paneth cells attenuates regeneration of aged intestinal epithelium
    Pentinmikko N, Iqbal S, Mana M, Andersson S, Cognetta AB, 3rd, Suciu RM, Roper J, Luopajarvi K, Markelin E and Katajisto P <14 more author(s)>
    Ref: Nature, 571:398, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer