Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: neimb-q9k0t9

Neisseria meningitidis; Haemophilus parahaemolyticus; Neisseria gonorrhoeae, bioC1 Dithiobiotin synthetase ; EC=6.3.3.3

Comment
Other strains: Neisseria meningitidis (serogroup B.(MC58); alpha153; serogroup C / serotype 2a; ATCC 700532; alpha14; alpha275; LNP21362; serogroup A / serotype 4A; serogroup B; serogroup B / serotype 15; strain Z2491; strain alpha710; strain H44/76 LNP27256; alpha522; 81858; NZ-05/33; serogroup C (strains 053442; 8013); ATCC 13091; 93004); Haemophilus parahaemolyticus; Neisseria gonorrhoeae; Neisseria flavescens NRL30031/H210


Relationship
Family|Duf_452
Block| X
Position in NCBI Life Tree|Neisseria meningitidis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Neisseriales: N E > Neisseriaceae: N E > Neisseria: N E > Neisseria meningitidis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 17 more: AE002098, AM889137, AM421808
>3 UniProt links 4 more: Q9K0T9, C6SCZ5, A1KVF5
>3 UniProt links 16 more: Q9K0T9, C6SCZ5, A1KVF5
>3 Interpro links 16 more: Q9K0T9, C6SCZ5, A1KVF5
>3 Prodom links 16 more: Q9K0T9, C6SCZ5, A1KVF5
>3 Pfam links 16 more: Q9K0T9, C6SCZ5, A1KVF5
>3 PIRSF links 16 more: Q9K0T9, C6SCZ5, A1KVF5
>3 SUPERFAM links 16 more: Q9K0T9, C6SCZ5, A1KVF5
Sequence
Graphical view for this peptide sequence: neimb-q9k0t9
Colored MSA for Duf_452 (raw)
METKFYNHQGGHLILYFAGWGTPPDAVNHLILPENHDLLICYDYQDLNLD
FDFSAYRHIRLVAWSMGVWAAERALQGIRLKSATAVNGTGLPCDDNFGIP
CTVFKGTLENLTENTRLKFERRMCGDKASFEDYQQFPARPFGEIHQELIA
LFAMIGQDRRTDLIRWTNALVGSGDKIFMPANQHRYWTPRCTVREIDVGH
YLFSRFTHWSALWNH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

METKFYNHQGGHLILYFAGWGTPPDAVNHLILPENHDLLICYDYQDLNLD
FDFSAYRHIRLVAWSMGVWAAERALQGIRLKSATAVNGTGLPCDDNFGIP
CTVFKGTLENLTENTRLKFERRMCGDKASFEDYQQFPARPFGEIHQELIA
LFAMIGQDRRTDLIRWTNALVGSGDKIFMPANQHRYWTPRCTVREIDVGH
YLFSRFTHWSALWNH


References
3 more
    Title: Whole-genome comparison of disease and carriage strains provides insights into virulence evolution in Neisseria meningitidis
    Schoen C, Blom J, Claus H, Schramm-Gluck A, Brandt P, Muller T, Goesmann A, Joseph B, Konietzny S and Frosch M <5 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 105:3473, 2008 : PubMed

            

    Title: Meningococcal genetic variation mechanisms viewed through comparative analysis of serogroup C strain FAM18
    Bentley SD, Vernikos GS, Snyder LA, Churcher C, Arrowsmith C, Chillingworth T, Cronin A, Davis PH, Holroyd NE and Parkhill J <11 more author(s)>
    Ref: PLoS Genet, 3:e23, 2007 : PubMed

            

    Title: Complete genome sequence of Neisseria meningitidis serogroup B strain MC58
    Tettelin H, Saunders NJ, Heidelberg J, Jeffries AC, Nelson KE, Eisen JA, Ketchum KA, Hood DW, Peden JF and Venter JC <32 more author(s)>
    Ref: Science, 287:1809, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer