Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysi-a2wn01

Oryza sativa subsp. indica (Rice) Putative uncharacterized protein

Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Oryza sativa subsp. indica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E > Oryza sativa Indica Group: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : CM000126, AP000570, AP000492
2 UniProt : A2WN01, Q5NBT2
2 UniProt : A2WN01, Q5NBT2
2 Interpro : A2WN01, Q5NBT2
2 Pfam : A2WN01, Q5NBT2
2 PIRSF : A2WN01, Q5NBT2
2 SUPERFAM : A2WN01, Q5NBT2
Sequence
Graphical view for this peptide sequence: orysi-a2wn01
Colored MSA for Epoxide_hydrolase (raw)
MAAAAVRHREVEVASGVRLHVAESGPEGGPVALLVHGFPELWYSWRHQMR
ALAARGFRAVAPDLRGYGDSDAPQGRDSYTVLHLVGDLVALIADLGRPQG
DLVGALKVFVAGHDWGAVVAWQLCLLRPDLVTAHVSLSVEYQPDERAPGR
QGSLRGRSLRVPLPGILMHMQKPGVAEAEFARLDLNHLFKMVFGMRKPAT
IILPQDKTFFDAIDSDGTCPPWLSEEDISYYADKFGKTGFTGGFNYYRCI
DLDWELTAPWTGALINVPTKFIVGDLDLTYNTPGVKDYIHKGGFKANVPN
LEDVVVLEGVGHFINQEKPDEVSEHICEFFSKFLM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAAAVRHREVEVASGVRLHVAESGPEGGPVALLVHGFPELWYSWRHQMR
ALAARGFRAVAPDLRGYGDSDAPQGRDSYTVLHLVGDLVALIADLGRPQG
DLVGALKVFVAGHDWGAVVAWQLCLLRPDLVTAHVSLSVEYQPDERAPGR
QGSLRGRSLRVPLPGILMHMQKPGVAEAEFARLDLNHLFKMVFGMRKPAT
IILPQDKTFFDAIDSDGTCPPWLSEEDISYYADKFGKTGFTGGFNYYRCI
DLDWELTAPWTGALINVPTKFIVGDLDLTYNTPGVKDYIHKGGFKANVPN
LEDVVVLEGVGHFINQEKPDEVSEHICEFFSKFLM


References
    Title: The Genomes of Oryza sativa: a history of duplications
    Yu J, Wang J, Lin W, Li S, Li H, Zhou J, Ni P, Dong W, Hu S and Yang H <88 more author(s)>
    Ref: PLoS Biol, 3:e38, 2005 : PubMed

            

    Title: The genome sequence and structure of rice chromosome 1
    Sasaki T, Matsumoto T, Yamamoto K, Sakata K, Baba T, Katayose Y, Wu J, Niimura Y, Cheng Z and Gojobori T <69 more author(s)>
    Ref: Nature, 420:312, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer