Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pseae-llipa

Pseudomonas aeruginosa gene for lactonizing lipase triacylglycerol lipase (EC 3.1.1.3) lip lipA PA2862 PaLipA

Comment
Other strains: Pseudomonas aeruginosa (strain LESB58; UCBPP-PA14; 2192; PA7; 39016; C3719), Pseudomonas sp. 42A2


Relationship
Family|Bacterial_lip_FamI.1
Block| L
Position in NCBI Life Tree|Pseudomonas aeruginosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas aeruginosa group: N E > Pseudomonas aeruginosa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
1EX9: Pseudomonas aeruginosa lipase complexed with RC-(RP,SP)-1,2-dioctylcarbamoyl-glycero-3-O-octylphosphonate
No kinetic





7 substrates (e.g. : Triacetin, Tributyrin, Tricaprin... more)
2 inhibitors: Bis(N-propylcarbamic-acid)ethylene-ester, OCP
>3 Genbank links 1 more: AY682924, AF237723, X63390
>3 UniProt links 6 more: P26876, Q6B4I3, Q9L6C7
1 Ncbi-nid : 45340
1 Structure : 1EX9
>3 UniProt links 6 more: Q6B4I3, P26876, Q9L6C7
>3 Interpro links 6 more: Q6B4I3, P26876, Q9L6C7
>3 Pfam links 6 more: Q6B4I3, P26876, Q9L6C7
>3 PIRSF links 6 more: Q6B4I3, P26876, Q9L6C7
>3 SUPERFAM links 6 more: Q6B4I3, P26876, Q9L6C7
Sequence
Graphical view for this peptide sequence: pseae-llipa
Colored MSA for Bacterial_lip_FamI.1 (raw)
MKKKSLLPLGLAIGLASLAASPLIQASTYTQTKYPIVLAHGMLGFDNILG
VDYWFGIPSALRRDGAQVYVTEVSQLDTSEVRGEQLLQQVEEIVALSGQP
KVNLIGHSHGGPTIRYVAAVRPDLIASATSVGAPHKGSDTADFLRQIPPG
SAGEAVLSGLVNSLGALISFLSSGSTGTQNSLGSLESLNSEGAARFNAKY
PQGIPTSACGEGAYKVNGVSYYSWSGSSPLTNFLDPSDAFLGASSLTFKN
GTANDGLVGTCSSHLGMVIRDNYRMNHLDEVNQVFGLTSLFETSPVSVYR
QHANRLKNASL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKKSLLPLGLAIGLASLAASPLIQASTYTQTKYPIVLAHGMLGFDNILG
VDYWFGIPSALRRDGAQVYVTEVSQLDTSEVRGEQLLQQVEEIVALSGQP
KVNLIGHSHGGPTIRYVAAVRPDLIASATSVGAPHKGSDTADFLRQIPPG
SAGEAVLSGLVNSLGALISFLSSGSTGTQNSLGSLESLNSEGAARFNAKY
PQGIPTSACGEGAYKVNGVSYYSWSGSSPLTNFLDPSDAFLGASSLTFKN
GTANDGLVGTCSSHLGMVIRDNYRMNHLDEVNQVFGLTSLFETSPVSVYR
QHANRLKNASL


References
15 more
    Title: The Membrane-Integrated Steric Chaperone Lif Facilitates Active Site Opening of Pseudomonas aeruginosa Lipase A
    Verma N, Dollinger P, Kovacic F, Jaeger KE, Gohlke H
    Ref: J Comput Chem, 41:500, 2020 : PubMed

            

    Title: Understanding domain movements and interactions of Pseudomonas aeruginosa lipase with lipid molecule tristearoyl glycerol: A molecular dynamics approach
    Thiruvengadam K, Baskaran SK, Pennathur G
    Ref: J Mol Graph Model, 85:190, 2018 : PubMed

            

    Title: Pressure-induced conformational switch of an interfacial protein
    Johnson QR, Lindsay RJ, Nellas RB, Shen T
    Ref: Proteins, 84:820, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer