Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: schpo-PCY1

Schizosaccharomyces pombe (Fission yeast) carboxypeptidase y precursor (EC 3.4.16.5) (carboxypeptidase yscy)

Comment
only c-term Pfam A Peptidase_S10 578 998


Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Schizosaccharomyces pombe
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > Taphrinomycotina: N E > Schizosaccharomycetes: N E > Schizosaccharomycetales: N E > Schizosaccharomycetaceae: N E > Schizosaccharomyces: N E > Schizosaccharomyces pombe: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : D86560, Z97209
1 UniProt : O13849
1 UniProt : O13849
1 Interpro : O13849
1 Prodom : O13849
1 Pfam : O13849
1 PIRSF : O13849
1 SUPERFAM : O13849
Sequence
Graphical view for this peptide sequence: schpo-PCY1
Colored MSA for Carboxypeptidase_S10 (raw)
QYTGYLDVEDDRHLFFWFFESRNDPENDPVVLWLNGGPGCSSLTGLFMEL
GPSSINIETLKPEYNPHSWNSNASVIFLDQPINTGFSNGDDSVLDTVTAG
KDVYAFLNLFFAKFPQYAHLDFHIAGESYAGHYIPQFAKEIMEHNQGANF
FVASGYEMEKQYINLKSVLIGNGLTDPLVQYYFYGKMACESPYGPIMSQE
ECDRITGAYDTCAKLITGCYQTGFTPVCIGASLYCNNAMIGPFTKTGLNI
YDIREECRDQEHLCYPETGAIESYLNQEFVQEALGVEYDYKGCNTEVNIG
FLFKGDWMRKTFRDDVTAILEAGLPVLIYAGDADYICNYMGNEAWTDALE
WAGQREFYEAELKPWSPNGKEAGRGKSFKNFGYLRLYEAGHMVPFNQPEA
SLEMLNSWIDGSLFA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

QYTGYLDVEDDRHLFFWFFESRNDPENDPVVLWLNGGPGCSSLTGLFMEL
GPSSINIETLKPEYNPHSWNSNASVIFLDQPINTGFSNGDDSVLDTVTAG
KDVYAFLNLFFAKFPQYAHLDFHIAGESYAGHYIPQFAKEIMEHNQGANF
FVASGYEMEKQYINLKSVLIGNGLTDPLVQYYFYGKMACESPYGPIMSQE
ECDRITGAYDTCAKLITGCYQTGFTPVCIGASLYCNNAMIGPFTKTGLNI
YDIREECRDQEHLCYPETGAIESYLNQEFVQEALGVEYDYKGCNTEVNIG
FLFKGDWMRKTFRDDVTAILEAGLPVLIYAGDADYICNYMGNEAWTDALE
WAGQREFYEAELKPWSPNGKEAGRGKSFKNFGYLRLYEAGHMVPFNQPEA
SLEMLNSWIDGSLFA


References
    Title: The genome sequence of Schizosaccharomyces pombe
    Wood V, Gwilliam R, Rajandream MA, Lyne M, Lyne R, Stewart A, Sgouros J, Peat N, Hayles J and Nurse P <124 more author(s)>
    Ref: Nature, 415:871, 2002 : PubMed

            

    Title: Vacuolar protein sorting in fission yeast: cloning, biosynthesis, transport, and processing of carboxypeptidase Y from Schizosaccharomyces pombe
    Tabuchi M, Iwaihara O, Ohtani Y, Ohuchi N, Sakurai J, Morita T, Iwahara S, Takegawa K
    Ref: Journal of Bacteriology, 179:4179, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer