anoga-a0neb7

Anopheles gambiae; Anopheles arabiensis; Anopheles quadriannulatus carboxylesterase, beta esterase (agap005373-pa)

Comment

"Other strains: Anopheles gambiae\; Anopheles arabiensis\; Anopheles quadriannulatus"

Relationship

Family : Carb_B_Arthropoda

Block : C

Position in NCBI Life Tree : Anopheles gambiae

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MEVQIASFRWICLIILGFSTPFVVGHDSAIVVNIQNGPIA
GERRGDYYAF EGIPYAKPPLGKLRFASSELNDDRWTEPR
STTKPGSICLQWAHFNKTKDK LKGAEDCLFLNVYTTSID
PTVRLPTIAFIHGGAFMFGAGSKSKPDHIIKR HIVLVTF
NYRLGPLGFLSTEDDVIPGNFGLKDQVIALQWIRENIESF
GGD PETVSIVGYSAGSASVHLHYLSPLSRGLFTSGIGHS
GSALNPWTMAEKST EKAKQIGSALGCPIRTSQTLLECLR
NVPAEDIVRQVSQFLDFLYNPFSPF GAVVEREGSLNPHP
FLKETPRSLMSSGNVAKAPLILSVTQAEGLYPGAEF ISD
HKYIQAIDSRWNELVPSILDYKTAVGDLKTRDHLSETIRS
RYFQGND RLSLNNFNVLIQIISNRLYFAGVTESIKLMQP
HTKVYVYVNYFKIKYGIG EKLSKGADTTYLGVSHGEDVD
LVFHSIAREHLPYTKEERIVINRFVTMYK HFAKGAAPRF
GSHTLPLQDDRDKISYLKLNYPQSVVICASGLNDEEFWNS
LDFNDAPYERICNSNPGIDE

References

Title : The genome sequence of the malaria mosquito Anopheles gambiae - Holt_2002_Science_298_129
Author(s) : Holt RA , Subramanian GM , Halpern A , Sutton GG , Charlab R , Nusskern DR , Wincker P , Clark AG , Ribeiro JM , Wides R , Salzberg SL , Loftus B , Yandell M , Majoros WH , Rusch DB , Lai Z , Kraft CL , Abril JF , Anthouard V , Arensburger P , Atkinson PW , Baden H , de Berardinis V , Baldwin D , Benes V , Biedler J , Blass C , Bolanos R , Boscus D , Barnstead M , Cai S , Center A , Chaturverdi K , Christophides GK , Chrystal MA , Clamp M , Cravchik A , Curwen V , Dana A , Delcher A , Dew I , Evans CA , Flanigan M , Grundschober-Freimoser A , Friedli L , Gu Z , Guan P , Guigo R , Hillenmeyer ME , Hladun SL , Hogan JR , Hong YS , Hoover J , Jaillon O , Ke Z , Kodira C , Kokoza E , Koutsos A , Letunic I , Levitsky A , Liang Y , Lin JJ , Lobo NF , Lopez JR , Malek JA , McIntosh TC , Meister S , Miller J , Mobarry C , Mongin E , Murphy SD , O'Brochta DA , Pfannkoch C , Qi R , Regier MA , Remington K , Shao H , Sharakhova MV , Sitter CD , Shetty J , Smith TJ , Strong R , Sun J , Thomasova D , Ton LQ , Topalis P , Tu Z , Unger MF , Walenz B , Wang A , Wang J , Wang M , Wang X , Woodford KJ , Wortman JR , Wu M , Yao A , Zdobnov EM , Zhang H , Zhao Q , Zhao S , Zhu SC , Zhimulev I , Coluzzi M , della Torre A , Roth CW , Louis C , Kalush F , Mural RJ , Myers EW , Adams MD , Smith HO , Broder S , Gardner MJ , Fraser CM , Birney E , Bork P , Brey PT , Venter JC , Weissenbach J , Kafatos FC , Collins FH , Hoffman SL
Ref : Science , 298 :129 , 2002
Abstract : Holt_2002_Science_298_129
ESTHER : Holt_2002_Science_298_129
PubMedSearch : Holt_2002_Science_298_129
PubMedID: 12364791
Gene_locus related to this paper: anoga-a0nb77 , anoga-a0nbp6 , anoga-a0neb7 , anoga-a0nei9 , anoga-a0nej0 , anoga-a0ngj1 , anoga-a7ut12 , anoga-a7uuz9 , anoga-ACHE1 , anoga-ACHE2 , anoga-agCG44620 , anoga-agCG44666 , anoga-agCG45273 , anoga-agCG45279 , anoga-agCG45511 , anoga-agCG46741 , anoga-agCG47651 , anoga-agCG47655 , anoga-agCG47661 , anoga-agCG47690 , anoga-agCG48797 , anoga-AGCG49362 , anoga-agCG49462 , anoga-agCG49870 , anoga-agCG49872 , anoga-agCG49876 , anoga-agCG50851 , anoga-agCG51879 , anoga-agCG52383 , anoga-agCG54954 , anoga-AGCG55021 , anoga-agCG55401 , anoga-agCG55408 , anoga-agCG56978 , anoga-ebiG239 , anoga-ebiG2660 , anoga-ebiG5718 , anoga-ebiG5974 , anoga-ebiG8504 , anoga-ebiG8742 , anoga-glita , anoga-nrtac , anoga-q5tpv0 , anoga-Q5TVS6 , anoga-q7pm39 , anoga-q7ppw9 , anoga-q7pq17 , anoga-Q7PQT0 , anoga-q7q8m4 , anoga-q7q626 , anoga-q7qa14 , anoga-q7qa52 , anoga-q7qal7 , anoga-q7qbj0 , anoga-f5hl20 , anoga-q7qkh2 , anoga-a0a1s4h1y7 , anoga-q7q887