Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: agrtu-DHAA

Agrobacterium tumefaciens, Agrobacterium radiobacter, haloalkane dehalogenase DatA

Comment
Other strains: Agrobacterium tumefaciens (strain C58 / ATCC 33970) Agrobacterium radiobacter (strain K84 / ATCC BAA-868) Rhizobium radiobacter (Agrobacterium tumefaciens)


Relationship
Family|Haloalkane_dehalogenase-HLD2
Block| X
Position in NCBI Life Tree|Agrobacterium tumefaciens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Rhizobiaceae: N E > Rhizobium/Agrobacterium group: N E > Agrobacterium: N E > Agrobacterium tumefaciens complex: N E > Agrobacterium tumefaciens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
>3 Genbank links 1 more: AE009425, AE007933, CP000630
3 UniProt : Q8U671, B9JPJ9, E2RV69
2 Structure : 3WIB, 3WI7
3 UniProt : Q8U671, B9JPJ9, E2RV69
3 Interpro : Q8U671, B9JPJ9, E2RV69
3 Prodom : Q8U671, B9JPJ9, E2RV69
3 Pfam : Q8U671, B9JPJ9, E2RV69
3 PIRSF : Q8U671, B9JPJ9, E2RV69
3 SUPERFAM : Q8U671, B9JPJ9, E2RV69
Sequence
Graphical view for this peptide sequence: agrtu-DHAA
Colored MSA for Haloalkane_dehalogenase-HLD2 (raw)
MKEHRHMTEKSPHSAFGDGAKAYDVPAFGLQIHTVEHGSGAPIVFLHGNP
TSSYLWRHIFRRLHGHGRLLAVDLIGYGQSSKPDIEYTLENQQRYVDAWF
DALDLRNVTLVLQDYGAAFGLNWASRNPDRVRAVAFFEPVLRNIDSVDLS
PEFVTRRAKLRQPGEGEIFVQQENRFLTELFPWFFLTPLAPEDLRQYQTP
FPTPHSRKAILAGPRNLPVDGEPASTVAFLEQAVNWLNTSDTPKLLLTFK
PGFLLTDAILKWSQVTIRNLEIEAAGAGIHFVQEEQPETIARLLDAWLTR
IAGN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKEHRHMTEKSPHSAFGDGAKAYDVPAFGLQIHTVEHGSGAPIVFLHGNP
TSSYLWRHIFRRLHGHGRLLAVDLIGYGQSSKPDIEYTLENQQRYVDAWF
DALDLRNVTLVLQDYGAAFGLNWASRNPDRVRAVAFFEPVLRNIDSVDLS
PEFVTRRAKLRQPGEGEIFVQQENRFLTELFPWFFLTPLAPEDLRQYQTP
FPTPHSRKAILAGPRNLPVDGEPASTVAFLEQAVNWLNTSDTPKLLLTFK
PGFLLTDAILKWSQVTIRNLEIEAAGAGIHFVQEEQPETIARLLDAWLTR
IAGN


References
2 more
    Title: Crystal structure of the novel haloalkane dehalogenase DatA from Agrobacterium tumefaciens C58 reveals a special halide-stabilizing pair and enantioselectivity mechanism
    Guan L, Yabuki H, Okai M, Ohtsuka J, Tanokura M
    Ref: Applied Microbiology & Biotechnology, 98:8573, 2014 : PubMed

            

    Title: Substrate specificity of haloalkane dehalogenases
    Koudelakova T, Chovancova E, Brezovsky J, Monincova M, Fortova A, Jarkovsky J, Damborsky J
    Ref: Biochemical Journal, 435:345, 2011 : PubMed

            

    Title: The genome of the natural genetic engineer Agrobacterium tumefaciens C58
    Wood DW, Setubal JC, Kaul R, Monks DE, Kitajima JP, Okura VK, Zhou Y, Chen L, Wood GE and Nester EW <41 more author(s)>
    Ref: Science, 294:2317, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer