Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-B9DFR3

Arabidopsis thaliana (Mouse-ear cress). Pectin acetylesterase 9 AtPAE9

Relationship
Family|Pectinacetylesterase-Notum
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AB005244, CP002688, AK316872
2 UniProt : B9DFR3, F4KEB8
2 UniProt : B9DFR3, F4KEB8
2 Interpro : B9DFR3, F4KEB8
2 Prodom : B9DFR3, F4KEB8
2 Pfam : B9DFR3, F4KEB8
2 PIRSF : B9DFR3, F4KEB8
2 SUPERFAM : B9DFR3, F4KEB8
1 Tair database : At5g23870
Sequence
Graphical view for this peptide sequence: arath-B9DFR3
Colored MSA for Pectinacetylesterase-Notum (raw)
MKTTTRLLDLTAAMVLVVYVSFSPPLVSGEPGRRVSMTLVRDAAALGAFC
LDGSLPAYHLDRGFGAGSNNWILQFEGGGWCNDIASCVERAKTRRGSTRY
MSKTVVFTGVLSNNASQNPDFYNWNKVRLRYCDGASFAGDSQFGNGTSLL
YFRGQRIWNAIILDLLPKGLAKAHKALLTGCSAGGLSTFLHCDNFTSYLP
KNASVKCMSDAGFFLDAIDVAANRTMRSFYSQLVSLQGIQKNLDPSCTHA
FFPEPSLCFFPQYVLRFIKTPFFILNSAYDVFQFHHGLVPPSADQTGRWN
RCKLNVTACNPHQLDALQGFRKDMLGALMNFFRNSTRGGMFINSCFDHCQ
SALEETWLSPTSPRINNKTIAETVGDWYFGRGEEAKEIGCPYPCDKTCHN
LIPASTSDFLASNASGSGHNSRGTHLTFLFLLLNFFFFFVISKFSKKDYV
T
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKTTTRLLDLTAAMVLVVYVSFSPPLVSGEPGRRVSMTLVRDAAALGAFC
LDGSLPAYHLDRGFGAGSNNWILQFEGGGWCNDIASCVERAKTRRGSTRY
MSKTVVFTGVLSNNASQNPDFYNWNKVRLRYCDGASFAGDSQFGNGTSLL
YFRGQRIWNAIILDLLPKGLAKAHKALLTGCSAGGLSTFLHCDNFTSYLP
KNASVKCMSDAGFFLDAIDVAANRTMRSFYSQLVSLQGIQKNLDPSCTHA
FFPEPSLCFFPQYVLRFIKTPFFILNSAYDVFQFHHGLVPPSADQTGRWN
RCKLNVTACNPHQLDALQGFRKDMLGALMNFFRNSTRGGMFINSCFDHCQ
SALEETWLSPTSPRINNKTIAETVGDWYFGRGEEAKEIGCPYPCDKTCHN
LIPASTSDFLASNASGSGHNSRGTHLTFLFLLLNFFFFFVISKFSKKDYV
T


References
3 more
    Title: Plant pectin acetylesterase structure and function: new insights from bioinformatic analysis
    Philippe F, Pelloux J, Rayon C
    Ref: BMC Genomics, 18:456, 2017 : PubMed

            

    Title: Analysis of multiple occurrences of alternative splicing events in Arabidopsis thaliana using novel sequenced full-length cDNAs
    Iida K, Fukami-Kobayashi K, Toyoda A, Sakaki Y, Kobayashi M, Seki M, Shinozaki K
    Ref: DNA Research, 16:155, 2009 : PubMed

            

    Title: Structural analysis of Arabidopsis thaliana chromosome 5. I. Sequence features of the 1.6 Mb regions covered by twenty physically assigned P1 clones
    Sato S, Kotani H, Nakamura Y, Kaneko T, Asamizu E, Fukami M, Miyajima N, Tabata S
    Ref: DNA Research, 4:215, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer