bacsu-YJCH

 
Bacillus subtilis yjch (and subsp. natto BEST195) protein

Relationship
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : Z99110, AP011541
2 UniProt : O31630, D4FV63
2 UniProtTrembl : O31630, D4FV63
2 Interpro : O31630, D4FV63
2 Prodom : O31630, D4FV63
2 Pfam : O31630, D4FV63
2 PIRSF : O31630, D4FV63
2 SUPERFAM : O31630, D4FV63
2 QuickSwissBlast : O31630, D4FV63
 
Sequence
Graphical view for this peptide sequence: bacsu-YJCH
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MAPKNGTVQEKKFFSKELNEEMTLLVYLPSNYSPLYKYHVIIAQDGHDYF
RLGRIGRQVEELLSKREIDRSIIIGVPYKDVKERRNTYHPEGSKFSAYKR
FIAHELVPFADDEYPTYQIGYGRTLIGDSLGATVSLMTALDYPNMFGNII
MQSPYVDKHVLEAVKQSDDIKHLSIYHQIGTKETDVHTTDGNILDFTEPN
RELKQLLEKKLSDYDFEPFDGDHKWTYWQPLITPALKKML
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAPKNGTVQEKKFFSKELNEEMTLLVYLPSNYSPLYKYHVIIAQDGHDYF
RLGRIGRQVEELLSKREIDRSIIIGVPYKDVKERRNTYHPEGSKFSAYKR
FIAHELVPFADDEYPTYQIGYGRTLIGDSLGATVSLMTALDYPNMFGNII
MQSPYVDKHVLEAVKQSDDIKHLSIYHQIGTKETDVHTTDGNILDFTEPN
RELKQLLEKKLSDYDFEPFDGDHKWTYWQPLITPALKKML

no DNA




References
    Title: Whole genome assembly of a natto production strain Bacillus subtilis natto from very short read data
    Nishito Y, Osana Y, Hachiya T, Popendorf K, Toyoda A, Fujiyama A, Itaya M, Sakakibara Y
    Ref: BMC Genomics, 11:243, 2010 : PubMed

            

    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer