bacsu-ydjp

 
Bacillus subtilis BAA22772.1 (and subsp. natto BEST195) peroxydase

Relationship
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : AB007638, AP011541
2 UniProt : O34592, D4G5Y2
1 Ncbi-nid : 2522006
1 Ncbi-pid : 2522021
2 UniProtTrembl : O34592, D4G5Y2
2 Interpro : O34592, D4G5Y2
2 Prodom : O34592, D4G5Y2
2 Pfam : O34592, D4G5Y2
2 PIRSF : O34592, D4G5Y2
2 SUPERFAM : O34592, D4G5Y2
2 QuickSwissBlast : O34592, D4G5Y2
 
Sequence
Graphical view for this peptide sequence: bacsu-ydjp
Colored MSA for Haloperoxidase (raw)
MPYIILEDQTRLYYETHGSGTPILFIHGVLMSGQFFHKQFSVLSANYQCI
RLDLRGHGESDKVLHGHTISQYARDIREFLNAMELDHVVLAGWSMGAFVV
WDYLNQFGNDNIQAAVIIDQSASDYQWEGWEHGPFDFDGLKTAMHAIQTD
PLPFYESFIQNMFAEPPAETETEWMLAEILKQPAAISSTILFNQTAADYR
GTLQNINVPALLCFGEDKKFFSTAAGEHLRSNIPNATLVTFPKSSHCPFL
EEPDAFNSTLLSFLDGVIGKS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPYIILEDQTRLYYETHGSGTPILFIHGVLMSGQFFHKQFSVLSANYQCI
RLDLRGHGESDKVLHGHTISQYARDIREFLNAMELDHVVLAGWSMGAFVV
WDYLNQFGNDNIQAAVIIDQSASDYQWEGWEHGPFDFDGLKTAMHAIQTD
PLPFYESFIQNMFAEPPAETETEWMLAEILKQPAAISSTILFNQTAADYR
GTLQNINVPALLCFGEDKKFFSTAAGEHLRSNIPNATLVTFPKSSHCPFL
EEPDAFNSTLLSFLDGVIGKS

Graphical view for this nucleotide DNA sequence (845 bp): bacsu-ydjp



References
1 more
    Title: Identification of target promoters for the Bacillus subtilis extracytoplasmic function sigma factor, sigma W
    Huang X, Gaballa A, Cao M, Helmann JD
    Ref: Molecular Microbiology, 31:361, 1999 : PubMed

            

    Title: Sequence analysis of the groESL-cotA region of the Bacillus subtilis genome, containing the restriction/modification system genes
    Kasahara Y, Nakai S, Ogasawara N, Yata K, Sadaie Y
    Ref: DNA Research, 4:335, 1997 : PubMed

            

    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer