Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacsu-yisY

Bacillus subtilis (and subsp. natto BEST195) yisY Haloperoxidase like

Relationship
Family|Haloperoxidase
Block| X
Position in NCBI Life Tree|Bacillus subtilis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : Z99109, Y09476, AP011541
2 UniProt : O06734, D4FUW9
1 Ncbi-nid : 2633260
1 Ncbi-pid : 2633426
2 UniProt : O06734, D4FUW9
2 Interpro : O06734, D4FUW9
2 Pfam : O06734, D4FUW9
2 PIRSF : O06734, D4FUW9
2 SUPERFAM : O06734, D4FUW9
Sequence
Graphical view for this peptide sequence: bacsu-yisY
Colored MSA for Haloperoxidase (raw)
MGHYIKTEEHVTLFVEDIGHGRPIIFLHGWPLNHKMFEYQMNELPKRGFR
FIGVDLRGYGQSDRPWEGYDYDTMADDVKAVIYTLQLENAILAGFSMGGA
IAIRYMARHEGADVDKLILLSAAAPAFTKRPGYPYGMRKQDIDDMIELFK
ADRPKTLADLGKQFFEKKVSPELRQWFLNLMLEASSYGTIHSGIALRDED
LRKELAAIKVPTLILHGRKDRIAPFDFAKELKRGIKQSELVPFANSGHGA
FYEEKEKINSLIAQFSNS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGHYIKTEEHVTLFVEDIGHGRPIIFLHGWPLNHKMFEYQMNELPKRGFR
FIGVDLRGYGQSDRPWEGYDYDTMADDVKAVIYTLQLENAILAGFSMGGA
IAIRYMARHEGADVDKLILLSAAAPAFTKRPGYPYGMRKQDIDDMIELFK
ADRPKTLADLGKQFFEKKVSPELRQWFLNLMLEASSYGTIHSGIALRDED
LRKELAAIKVPTLILHGRKDRIAPFDFAKELKRGIKQSELVPFANSGHGA
FYEEKEKINSLIAQFSNS


References
1 more
    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            

    Title: Sequencing of regions downstream of addA (98 degrees) and citG (289 degrees) in Bacillus subtilis
    Medina N, Vannier F, Roche B, Autret S, Levine A, Seror SJ
    Ref: Microbiology, 143 ( Pt 10):3305, 1997 : PubMed

            

    Title: A Bacillus subtilis chromosome segment at the 100 degrees to 102 degrees position encoding 11 membrane proteins
    Roche B, Autret S, Levine A, Vannier F, Medina N, Seror SJ
    Ref: Microbiology, 143 ( Pt 10):3309, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer