Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: burma-a5tq93

Burkholderia mallei (Pseudomonas mallei), Burkholderia pseudomallei (Pseudomonas pseudomallei) Conserved domain protein

Comment
Other strains: Burkholderia mallei (Pseudomonas mallei) (strains 2002721280; GB8 horse 4; NCTC 10247; ATCC 10399; SAVP1; FMH; NCTC 10229; JHU; PRL-20) Burkholderia pseudomallei (Pseudomonas pseudomallei) (strains MSHR346; 1710a; 1106b; 406e; 1710b; Pakistan 9; 668; Pasteur 52237; 1106a; 1655; 305; 576; S13; MSHR5855; 1026b; 1026a; 1258a; 1258b; 354e; 354a; BPC006; MSHR1043; MSHR305: NCTC 13179; NCTC 13178; NAU20B-16; MSHR511; MSHR146; MSHR338; MSHR520; MSHR6137)


Relationship
Family|Pectinacetylesterase-Notum
Block| X
Position in NCBI Life Tree|Burkholderia mallei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > pseudomallei group: N E > Burkholderia mallei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 41 more: CH899697, CP001408, CM000832
>3 UniProt links 6 more: C4KU02, C4AZ75, A8EG34
>3 UniProt links 6 more: C4KU02, C4AZ75, A8EG34
>3 Interpro links 6 more: C4KU02, C4AZ75, A8EG34
>3 Prodom links 6 more: C4KU02, C4AZ75, A8EG34
>3 Pfam links 6 more: C4KU02, C4AZ75, A8EG34
>3 PIRSF links 6 more: C4KU02, C4AZ75, A8EG34
>3 SUPERFAM links 6 more: C4KU02, C4AZ75, A8EG34
Sequence
Graphical view for this peptide sequence: burma-a5tq93
Colored MSA for Pectinacetylesterase-Notum (raw)
MEESMPVRECLECLRRLCVAGLLSAAAADGHAAVAAAQDPSIPYYSWYEV
TLPESSGASCGNGTPMRFYINRAQSDNLLYMMEPGGACWDHGTCTETATG
AQAGLGAFNPDGIPHNYVNGTVQQSLKTSFLSPLMTRMDLAHILVGEPKV
ETQEWTQVFVPYCTGDIHMGSAVRSYASPSGDWRIQHYSGLKNVRVIAQW
LVDHGFGKPSRLLVYGTSAGGYGTLGNYATLRGTLQPQSHSSLLDDAGTV
FNTRFGADPAAYPSVGLYDKVRDEWGMTAPDGMITVNSRLTRYFDPGNMG
SAYAALSATYPHDRFGYTTYRRDRIIAAYHYRPFVPAVIAAPDDATKDAL
SLAMFDRELSDLKQVLNPLPNFGYFIPWARDDFMGNHQVTAVSFTGSGIH
ENGIDADVGTFVADLLNQQDPADVPVMKAYRTEQWSDFTFSTFLAWLDSI
FNLTGEAGPISGHRS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEESMPVRECLECLRRLCVAGLLSAAAADGHAAVAAAQDPSIPYYSWYEV
TLPESSGASCGNGTPMRFYINRAQSDNLLYMMEPGGACWDHGTCTETATG
AQAGLGAFNPDGIPHNYVNGTVQQSLKTSFLSPLMTRMDLAHILVGEPKV
ETQEWTQVFVPYCTGDIHMGSAVRSYASPSGDWRIQHYSGLKNVRVIAQW
LVDHGFGKPSRLLVYGTSAGGYGTLGNYATLRGTLQPQSHSSLLDDAGTV
FNTRFGADPAAYPSVGLYDKVRDEWGMTAPDGMITVNSRLTRYFDPGNMG
SAYAALSATYPHDRFGYTTYRRDRIIAAYHYRPFVPAVIAAPDDATKDAL
SLAMFDRELSDLKQVLNPLPNFGYFIPWARDDFMGNHQVTAVSFTGSGIH
ENGIDADVGTFVADLLNQQDPADVPVMKAYRTEQWSDFTFSTFLAWLDSI
FNLTGEAGPISGHRS


References
3 more
    Title: First genome sequence of a Burkholderia pseudomallei Isolate in China, strain BPC006, obtained from a melioidosis patient in Hainan
    Fang Y, Huang Y, Li Q, Chen H, Yao Z, Pan J, Gu J, Tang B, Wang HG and Mao XH <3 more author(s)>
    Ref: Journal of Bacteriology, 194:6604, 2012 : PubMed

            

    Title: Genomic plasticity of the causative agent of melioidosis, Burkholderia pseudomallei
    Holden MT, Titball RW, Peacock SJ, Cerdeno-Tarraga AM, Atkins T, Crossman LC, Pitt T, Churcher C, Mungall K and Parkhill J <38 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:14240, 2004 : PubMed

            

    Title: Structural flexibility in the Burkholderia mallei genome
    Nierman WC, DeShazer D, Kim HS, Tettelin H, Nelson KE, Feldblyum T, Ulrich RL, Ronning CM, Brinkac LM and Fraser CM <23 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:14246, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer