Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ecoli-estX

Escherichia coli sat streptothricin acetyl-transferase (on plasmid) (and strains SMS-3-5/SECEC; H489 )

Comment
gene on plasmid present in very few strains and common to other bacteria


Relationship
Family|Aclacinomycin-methylesterase_RdmC
Block| X
Position in NCBI Life Tree|Escherichia coli
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Escherichia: N E > Escherichia coli: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 18 more: X56815, DQ286459, AFAB02000105
>3 UniProt links 15 more: Q56QZ8, B1LRV7, C1KAQ5
>3 UniProt links 14 more: Q56QZ8, B1LRV7, C1KAQ5
>3 Interpro links 14 more: Q56QZ8, B1LRV7, C1KAQ5
>3 Pfam links 14 more: Q56QZ8, B1LRV7, C1KAQ5
>3 PIRSF links 14 more: Q56QZ8, B1LRV7, C1KAQ5
>3 SUPERFAM links 14 more: Q56QZ8, B1LRV7, C1KAQ5
Sequence
Graphical view for this peptide sequence: ecoli-estX
Colored MSA for Aclacinomycin-methylesterase_RdmC (raw)
MKEKVVVDKAISLYTESFGDPAHEPIILIMGAMSSAVWWPDEFCSQLAKM
GRYVIRYDHRDTGKSTSYEPGQAPYSVEELADDVVRVIDGYGLEAAHLVG
MSLGGFLSQLVALKYPKRVKSLTLIASERLADADPDMPAFDPAIIEYHQR
AESLDWSDRDAVVAYQVGAWRINSGTAHAFDAEKIQNIAELNFDRTPNIL
TTFNHTTLGGGERWLGRLNEIAVPTLIIHGTEDPVLPYVHGLALKDAIRG
SKMLTLEGTGHELHHKDWPRIIQAIKGQTS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKEKVVVDKAISLYTESFGDPAHEPIILIMGAMSSAVWWPDEFCSQLAKM
GRYVIRYDHRDTGKSTSYEPGQAPYSVEELADDVVRVIDGYGLEAAHLVG
MSLGGFLSQLVALKYPKRVKSLTLIASERLADADPDMPAFDPAIIEYHQR
AESLDWSDRDAVVAYQVGAWRINSGTAHAFDAEKIQNIAELNFDRTPNIL
TTFNHTTLGGGERWLGRLNEIAVPTLIIHGTEDPVLPYVHGLALKDAIRG
SKMLTLEGTGHELHHKDWPRIIQAIKGQTS


References
11 more
    Title: Class 1 integrons lacking qacEDelta1 and sul1 genes in Escherichia coli isolates of food, animal and human origins
    Saenz Y, Vinue L, Ruiz E, Somalo S, Martinez S, Rojo-Bezares B, Zarazaga M, Torres C
    Ref: Vet Microbiol, 144:493, 2010 : PubMed

            

    Title: Insights into the environmental resistance gene pool from the genome sequence of the multidrug-resistant environmental isolate Escherichia coli SMS-3-5
    Fricke WF, Wright MS, Lindell AH, Harkins DM, Baker-Austin C, Ravel J, Stepanauskas R
    Ref: Journal of Bacteriology, 190:6779, 2008 : PubMed

            

    Title: Analysis and distribution of class 1 and class 2 integrons and associated gene cassettes among Escherichia coli isolates from swine, horses, cats and dogs collected in the BfT-GermVet monitoring study
    Kadlec K, Schwarz S
    Ref: J Antimicrob Chemother, 62:469, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer