Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: fusox-a0a1d3s5h0

Fusarium oxysporum (Fusarium vascular wilt) type C feruloyl esterase FoFaeC; Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi); Gibberella moniliformis; (Maize ear and stalk rot fungus); Fusarium mangiferae. faeC Carboxylic ester hydrolase

Comment
Other strains: Fusarium oxysporum f. sp. (raphani 54005; vasinfectum 25433; cubense; FOSC 3-a; pisi HDV247; conglutinans race 2 54008; melonis 26406; lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) (Fusarium vascular wilt of tomato); cubense (race 4; tropical race 4 54006) (Panama disease fungus); Fo47; Fusarium proliferatum ET1; Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi); Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides); Fusarium mangiferae


Relationship
Family|Tannase
Block| X
Position in NCBI Life Tree|Fusarium oxysporum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium oxysporum species complex: N E > Fusarium oxysporum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6FAT: The crystal structure of a feruloyl esterase C from Fusarium oxysporum.
No kinetic





No Substrate
No inhibitor
>3 Genbank links 18 more: LT615226, KI979327, KK035228
>3 UniProt links 15 more: A0A1D3S5H0, X0BZN3, X0KPI6
1 Structure : 6FAT
>3 UniProt links 15 more: A0A1D3S5H0, X0BZN3, X0KPI6
>3 Interpro links 15 more: A0A1D3S5H0, X0BZN3, X0KPI6
>3 Prodom links 15 more: A0A1D3S5H0, X0BZN3, X0KPI6
>3 Pfam links 15 more: A0A1D3S5H0, X0BZN3, X0KPI6
>3 PIRSF links 15 more: A0A1D3S5H0, X0BZN3, X0KPI6
>3 SUPERFAM links 15 more: A0A1D3S5H0, X0BZN3, X0KPI6
Sequence
Graphical view for this peptide sequence: fusox-a0a1d3s5h0
Colored MSA for Tannase (raw)
SMDTSTDICLPQDNMRPTFLLFSGLGACAAAGKGDDFAAKCAGFKTSLKL
PNTKVWFTEHVPAGKNITFPDNHPTCTPKSTITDVEICRVAMFVTTGPKS
NLTLEAWLPSNWTGRFLSTGNGGMAGCIQYDDVAYGAGFGFATVGANNGH
NGTSAVSMYKNSGVVEDYVYRSVHTGTVLGKELTKKFYGKKHTKSYYLGC
STGGRQGWKEAQSFPDDFDGIVAGAPAMRFNGLQSRSGSFWGITGPPGAP
THLSPEEWAMVQKNVLVQCDEPLDGVADGILEDPNLCQYRPEALVCSKGQ
TKNCLTGPQIETVRKVFGPLYGNNGTYIYPRIPPGADQGFGFAIGEQPFP
YSTEWFQYVIWNDTKWDPNTIGPNDYQKASEVNPFNVETWEGDLSKFRKR
GSKIIHWHGLEDGLISSDNSMEYYNHVSATMGLSNTELDEFYRYFRVSGC
GHCSGGIGANRIGNNRANLGGKEAKNNVLLALVKWVEEGQAPETITGVRY
VNGATTGKVEVERRHCRYPYRNVWDRKGNYKNPDSWKCELPLEQKLISEE
DLNSAVD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SMDTSTDICLPQDNMRPTFLLFSGLGACAAAGKGDDFAAKCAGFKTSLKL
PNTKVWFTEHVPAGKNITFPDNHPTCTPKSTITDVEICRVAMFVTTGPKS
NLTLEAWLPSNWTGRFLSTGNGGMAGCIQYDDVAYGAGFGFATVGANNGH
NGTSAVSMYKNSGVVEDYVYRSVHTGTVLGKELTKKFYGKKHTKSYYLGC
STGGRQGWKEAQSFPDDFDGIVAGAPAMRFNGLQSRSGSFWGITGPPGAP
THLSPEEWAMVQKNVLVQCDEPLDGVADGILEDPNLCQYRPEALVCSKGQ
TKNCLTGPQIETVRKVFGPLYGNNGTYIYPRIPPGADQGFGFAIGEQPFP
YSTEWFQYVIWNDTKWDPNTIGPNDYQKASEVNPFNVETWEGDLSKFRKR
GSKIIHWHGLEDGLISSDNSMEYYNHVSATMGLSNTELDEFYRYFRVSGC
GHCSGGIGANRIGNNRANLGGKEAKNNVLLALVKWVEEGQAPETITGVRY
VNGATTGKVEVERRHCRYPYRNVWDRKGNYKNPDSWKCELPLEQKLISEE
DLNSAVD


References
6 more
    Title: The crystal structure of a Fusarium oxysporum feruloyl esterase that belongs to the tannase family
    Dimarogona M, Topakas E, Christakopoulos P, Chrysina ED
    Ref: FEBS Letters, :, 2020 : PubMed

            

    Title: Directed evolution of the type C feruloyl esterase from Fusarium oxysporum FoFaeC and molecular docking analysis of its improved variants
    Cerullo G, Varriale S, Bozonnet S, Antonopoulou I, Christakopoulos P, Rova U, Gherbovet O, Faure R, Piechot A and Faraco V <3 more author(s)>
    Ref: N Biotechnol, 51:14, 2019 : PubMed

            

    Title: Tailoring the specificity of the type C feruloyl esterase FoFaeC from Fusarium oxysporum towards methyl sinapate by rational redesign based on small molecule docking simulations
    Antonopoulou I, Hunt C, Cerullo G, Varriale S, Gerogianni A, Faraco V, Rova U, Christakopoulos P
    Ref: PLoS ONE, 13:e0198127, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer