Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: macmu-KANSL3

Macaca mulatta (Rhesus macaque) Uncharacterized protein KIAA1310

Relationship
Family|NLS3-Tex30
Block| X
Position in NCBI Life Tree|Macaca mulatta
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Cercopithecoidea: N E > Cercopithecidae: N E > Cercopithecinae: N E > Macaca: N E > Macaca mulatta: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: CM001265, JV636261, JU321999
>3 UniProt links 2 more: F7D937, G7NAN8, F7ADY9
>3 UniProt links 2 more: F7D937, G7NAN8, F7ADY9
>3 Interpro links 2 more: F7D937, G7NAN8, F7ADY9
>3 Prodom links 2 more: F7D937, G7NAN8, F7ADY9
>3 Pfam links 2 more: F7D937, G7NAN8, F7ADY9
>3 PIRSF links 2 more: F7D937, G7NAN8, F7ADY9
>3 SUPERFAM links 2 more: F7D937, G7NAN8, F7ADY9
Sequence
Graphical view for this peptide sequence: macmu-KANSL3
Colored MSA for NLS3-Tex30 (raw)
NKPSKLPGSPLILIASSGPSSSVFPTSRRHRFWQSQLSCLGKVIPVATHL
LNNGSGVGVLQCLEHMIGAVRSKVLEIHSHFPHKPIILIGWNTGALVACH
VSVMEYVTAVVCLGFPLLTVDGPRGDVDDPLLDMKTPVLFVIGQNSLQCH
PEAMEDFREKIRAENSLVVVGGADDNLRISKAKKKSEGLTQSMVDRCIQD
EIVDFLTGVLTRA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

NKPSKLPGSPLILIASSGPSSSVFPTSRRHRFWQSQLSCLGKVIPVATHL
LNNGSGVGVLQCLEHMIGAVRSKVLEIHSHFPHKPIILIGWNTGALVACH
VSVMEYVTAVVCLGFPLLTVDGPRGDVDDPLLDMKTPVLFVIGQNSLQCH
PEAMEDFREKIRAENSLVVVGGADDNLRISKAKKKSEGLTQSMVDRCIQD
EIVDFLTGVLTRA


References
    Title: Genome sequencing and comparison of two nonhuman primate animal models, the cynomolgus and Chinese rhesus macaques
    Yan G, Zhang G, Fang X, Zhang Y, Li C, Ling F, Cooper DN, Li Q, Li Y and Wang X <32 more author(s)>
    Ref: Nat Biotechnol, 29:1019, 2011 : PubMed

            

    Title: Evolutionary and biomedical insights from the rhesus macaque genome
    Gibbs RA, Rogers J, Katze MG, Bumgarner R, Weinstock GM, Mardis ER, Remington KA, Strausberg RL, Venter JC and Zwieg AS <166 more author(s)>
    Ref: Science, 316:222, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer