mouse-LIPK
Mus musculus (Mouse) LIPK Lipl2 weakly similar to triacylglycerol lipase
Comment
Q8BM14 Q7TML7 1 aa plus 1 in/del of 4aa different Relationship
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain. > cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
A85-EsteraseD-FGH :
mouse-ES10 Mus musculus esterase 10 .
ABHD6-Lip :
mouse-ABHD6 Mus musculus (Mouse) Monoacylglycerol lipase ABHD6 .
ABHD8 :
mouse-Abhd8 Mus musculus Q9JMF5-Abhd8 (Mouse) epoxide hydrolase (EC 3.3.2.3) .
ABHD10 :
mouse-abhda Mus musculus (Mouse) Abhydrolase domain-containing protein 10, mitochondrial.
ABHD11-Acetyl_transferase :
mouse-Abhd11 Mus musculus (Mouse) Abhydrolase domain-containing protein 11 Williams-Beuren syndrome chromosomal region 21 protein .
ABHD12-PHARC :
mouse-abd12 Mus musculus (Mouse) abhydrolase domain-containing protein 12 protein c20orf22 CT022 (fragment) ,
mouse-g3uzn6 Mus musculus (Mouse) Protein Abhd12b .
ABHD13-BEM46 :
mouse-Q80UX8 Mus musculus (Mouse) 1110065l07rik protein flj14906 fis Alpha/beta hydrolase domain-containing protein 13 .
ABHD16 :
mouse-Abhd16a Mus musculus (Mouse) Phosphatidylserine lipase ABHD16A, bat5 (hla-b-associated transcript 5) (ng26 protein) ,
mouse-Abhd16b Mus musculus (Mouse) similar to chromosome 20 open reading frame 135 .
ABHD17-depalmitoylase :
mouse-q7m759 Mus musculus (Mouse) cgi67 serine protease precursor ,
mouse-Q8VCV1 Mus musculus (Mouse) hypothetical protein ,
mouse-Q99JW1 Mus musculus (Mouse) similar to cgi-67 protein AB17A .
ABHD18 :
mouse-Q8C1A9 Mus musculus (Mouse)3110057O12RIK Hypothetical alpha/beta-Hydrolases/putative DNA-binding domain .
abh_upf0017 :
mouse-ABH15 Mus musculus (Mouse) alpha/beta-hydrolases domain-containing protein 15 ,
mouse-abhd1 Mus musculus (Mouse) lung alpha/beta hydrolase 1 (Labh1-pending) ,
mouse-abhd3 Mus musculus (Mouse) lung alpha/beta hydrolase fold protein 3 ,
mouse-ABHD2 Mus musculus (Mouse) alpha/beta hydrolase-2 fold protein 2210009N18RIK .
ACHE :
mouse-ACHE Mus musculus (Mouse) acetylcholinesterase.
Acidic_Lipase :
mouse-1lipg Mus musculus (Mouse) (EC 3.1.1.3) (Gastric lipase) (GL) 2310051b21rik protein ,
mouse-1llip Mus musculus (C57 Black/6X CBA) LAL mRNA for lysosomal acid lipase ,
mouse-LIPM Mus musculus (Mouse) LIPM Lipm Lipl3 riken cdna 4632427c23 gene ,
mouse-LIPN Mus musculus (Mouse) lipase-like, ab-hydrolase domain containing 3 (fragment) ,
mouse-Lipo1 Mus musculus (Mouse) lipase, gastric (EC 3.1.1.3) (gastric lipase) (gl) ,
mouse-Lipo2 Mus musculus (Mouse) Lipo2 Lipase ,
mouse-Lipo4 Mus musculus (Mouse) Lipo4 Lipase .
ACPH_Peptidase_S9 :
mouse-apeh Mus musculus (Mouse) hydrolase) (aph) (acylaminoacyl-peptidase) .
Acyl-CoA_Thioesterase :
mouse-acnt1 Mus musculus (Mouse) Acyl-coenzyme A amino acid N-acyltransferase 1 ,
mouse-acot1 Mus musculus (Mouse) hydrolase) ACOT1 (cte-I) cytosolic long chain Acyl-CoA thioesterase ,
mouse-acot2 Mus musculus (Mouse) (EC 3.1.2.2) very-long-chain Acyl-CoA thioesterase (MTE-I) ACOT2 ,
mouse-acot3 Mus musculus (Mouse) (peroxisomal long-chain Acyl-CoA thioesterase 2) (pte-IA) (EC 3.1.2.2) ,
mouse-acot4 Mus musculus (Mouse) peroxisomal long chain Acyl-CoA thioesterase Ib (pte-Ib) (pte-2b) ,
mouse-acot5 Mus musculus (Mouse) (peroxisomal cytosolic Acyl-CoA thioesterase Ic) ,
mouse-BAAT Mus musculus (Mouse) bile acid CoA: amino acid n-acyltransferase (EC 3.1.2.2) ,
mouse-ACOT6 Mus musculus (Mouse)acyl-CoA thioesterase 6 (EC 3.1.2.2). Weakly similar to peroxisomal acyl-coenzyme A thioester hydrolase2 ,
mouse-Q8BGG9 Mus musculus (Mouse) Similar to bile acid coenzyme A: amino acid N-acyltransferase .
Arb2_FAM172A :
mouse-f172a Mus musculus (Mouse). Cotranscriptional regulator FAM172A .
Arylacetamide_deacetylase :
mouse-adcl3 Mus musculus (Mouse) Arylacetamide deacetylase-like 3 ,
mouse-adcl4 Mus musculus (Mouse) Arylacetamide deacetylase-like 4 Hypothetical esterase/lipase/thioesterase family active site containing protein ,
mouse-aryla Mus musculus (Mouse) arylacetamide deacetylase and 5033417e09rik protein ,
mouse-Q8BLF1 Mus musculus (Mouse) KIAA1363 NCEH1 neutral cholesterol ester hydrolase 1 B230106I24RIK ,
mouse-b1avu7 Mus musculus (Mouse). Uncharacterized protein ,
mouse-b2rwd2 Mus musculus (Mouse). Arylacetamide deacetylase-like 2 ,
mouse-j3qpi0 Mus musculus (Mouse). Uncharacterized protein ,
mouse-w4vsp6 Mus musculus (Mouse). MCG67716 .
BCHE :
mouse-BCHE Mus musculus mRNA for butyrylcholinesterase .
Carboxypeptidase_S10 :
mouse-CPMac Mus musculus RIKEN 4933436L16RIK CPMac ,
mouse-Ppgb Mus musculus (Mouse) Lysosomal protective protein, Cathepsin A Ctsa, Protective protein for beta-galactosidase (Mo54) Ppgb,
mouse-RISC Mus musculus RISC retinoid-inducible serine carboxypeptidase HSCP1 (serine carboxypeptidase 1) .
Carb_B_Chordata :
mouse-cauxin Mus musculus (Mouse) est5a (Ces5a) est7 (Ces7) carboxylesterase-like urinary excreted protein ,
mouse-Ces1a Mus musculus Ces1a LOC2445 Q5FWH4 ,
mouse-Ces1b Mus musculus (Mouse) Putative uncharacterized protein Gm5158 ,
mouse-Ces1c Mus musculus mRNA for carboxylesterase, Ces1c lung surfactant convertase, Liver carboxylesterase N, PES-N clone MGC:18575 ,
mouse-Ces1d Mus musculus (Mouse) triacylglycerol hydrolase (tgh) Fatty acid ethyl ester synthase Carboxylesterase 3 (EC 3.1.1.1) ,
mouse-Ces1e Mus musculus esterase-22 (egasyn) Es-22 E.R.-targeting prot. of beta-glucuronidase ,
mouse-Ces1f Mus musculus (Mouse) carboxylesterase ML1, CESmML1 61.6 kda protein ES-4 (EC 3.1.1.1) ,
mouse-Ces1g Mus musculus Ces1g EST1 RIKEN 2cxes mRNA for carboxylesterase ,
mouse-Ces1h Mus musculus Ces1h RIKEN cDNA 2310039D24 gene (2310039D24Rik),XP_134476 ,
mouse-Ces2a Mus musculus (Mouse) Protein Ces2a Ces6 carboxylesterase 6 (Intestine, liver) AI266984 ,
mouse-Ces2b Mus musculus (Mouse) Ces2b hypothetical protein bc015286 ,
mouse-Ces2c Mus musculus (Mouse) Ces2c similar to carboxylesterase 2 (intestine, liver) Acylcarnitine hydrolase ,
mouse-Ces2d-ps Mus musculus (Mouse) Ces2d-ps carboxylesterase 2D, pseudogene ,
mouse-Ces2e Mus musculus Ces2e Ces5 carboxylesterase, Pyrethroid hydrolase ,
mouse-Ces2f Mus musculus (Mouse) Ces2f Uncharacterized protein ,
mouse-Ces2g Mus musculus (Mouse) hypothetical 62.7 kda protein ,
mouse-Ces2h Mus musculus Ces2h carboxylesterase 2 isoform 1 ,
mouse-Ces3a Mus musculus Ces3a liver carboxylesterase esterase 31 Es31 ,
mouse-Ces3b Mus musculus (Mouse) Liver carboxylesterase 31-like, Es31L ,
mouse-Ces4a Mus musculus (Mouse) Carboxylesterase 4A (Ces4a) Carboxylesterase 8 (Ces8) pI 6.1 esterase (ES-10) ES-HVEL .
CGI-58_ABHD5_ABHD4 :
mouse-abhd4 Mus musculus (Mouse) abhydrolase domain-containing protein 4 similar to hypothetical protein flj12816 ,
mouse-abhd5 Mus musculus (Mouse) cgi-58 RIKEN AK004873 gene .
Cholesterol_esterase :
mouse-pches Mus musculus pancreatic/mammary gland cholesterol esterase .
CIB-CCG1-interacting-factor-B :
mouse-c1ib Mus musculus (Mouse) ccg1-interacting factor b ,
mouse-Dorz1 Mus musculus (Mouse)1110013B16RIK Dorz1 similar to dkfzp564o243 protein .
CMBL :
mouse-CMBL Mus musculus (Mouse) Carboxymethylenebutenolidase homolog .
DPP4N_Peptidase_S9 :
mouse-dpp4 M.musculus mRNA for dipeptidyl peptidase IV ,
mouse-DPP6 Mus musculus (Mouse) dipeptidyl aminopeptidase-like protein 6 (fragment) ,
mouse-dpp8 Mus musculus RIKEN dpp8 ,
mouse-dpp9 Mus musculus (Mouse) dipeptidyl peptidase 9 homolog mflj00334 protein ,
mouse-dpp10 Mus musculus DPP-10 Dipeptidyl peptidase IV-related protein RIKEN cDNA 6430601K09 gene (6430601K09Rik), mRNA ,
mouse-FAP Mus musculus (Mouse) fibroblast activation protein .
Duf_676 :
mouse-F135A Mus musculus (Mouse) hypothetical Esterase/lipase/thioesterase family active site containing protein ,
mouse-Q9DAI6 Mus musculus (Mouse) family active site containing protein, similarity 135, member B .
Duf_726 :
mouse-tmco4 Mus musculus (Mouse) Transmembrane and coiled-coil domain-containing protein 4 .
Duf_829 :
mouse-tmm53 Mus musculus (Mouse) Transmembrane protein 53 .
Epoxide_hydrolase :
mouse-EPHX1 Mus musculus (Mouse) epoxide hydrolase mEH (EC 3.3.2.3) ,
mouse-ephx3 Mus musculus (Mouse) Abhd9 ephx3 Epoxide_hydrolase sequence ,
mouse-ephx4 Mus musculus (Mouse) epoxide hydrolase-related protein ,
mouse-hyes Mus musculus soluble epoxide hydrolase 2, cytoplasmic (Ephx2), mRNA.
FSH1 :
mouse-OVCA2 Mus musculus (Mouse) 2310011m22rik protein (ovca2) .
Hepatic_Lipase :
mouse-1hlip Mus musculus (Mouse), Mus spretus (Western Mediterranean mouse) (Algerian mouse) hepatic triacylglycerol lipase .
Hormone-sensitive_lipase_like :
mouse-hslip Mus musculus mRNA for hormone sensitive lipase .
Hydrolase_RBBP9_YdeN :
mouse-rbbp9 Mus musculus (Mouse), Mus spretus (Western Mediterranean mouse), (Retinoblastoma-binding protein 9 protein) B5T overexpressed gene protein (bog protein) .
Kynurenine-formamidase :
mouse-KFA Mus musculus Kynurenine formamidase (EC 3.5.1.9) Afmid Ammd cDNA 9030621K19 gene (9030621K19Rik) .
LIDHydrolase :
mouse-Ldah Mus musculus (Mouse) lipid droplet-associated hydrolase (LDAH) C2orf43 CB043 UPF0554 .
Lipase_3 :
mouse-DGLB Mus musculus (Mouse) Daglb Sn1-specific diacylglycerol lipase beta 64.9 kda protein ,
mouse-q6wqj1 Mus musculus (Mouse) Dagla neural stem cell-derived dendrite regulator DAGLA .
Lipoprotein_Lipase :
mouse-Lipg Mus musculus (Mouse) Lipg endothelial lipase ,
mouse-lipli Mus musculus lipoprotein lipase .
LYsophospholipase_carboxylesterase :
mouse-lypl1 Mus musculus (Mouse) lysophospholipase-like protein 1 (EC 3.1.2.-) 26.3 kda protein ,
mouse-lypla1 Mus musculus lysophospholipase 1 (Lypla1)(lysopla I), mRNA ,
mouse-lypla2 Mus musculus lysophospholipase 2 (Lypla2), mRNA .
Maspardin-ACP33-SPG21_like :
mouse-SPG21 Mus musculus (Mouse) hypothetical Maspardin-ACP33-SPG21 Spg21 Spastic paraplegia 21 homolog (Human) .
MEST-like :
mouse-MEST Mus musculus Mouse and Mus musculus molossinus (Japanese house mouse) Mesoderm-specific transcript protein .
Monoglyceridelipase_lysophospholip :
mouse-MGLL Mus musculus (Mouse) monoglyceride lipase (EC 3.1.1.23) .
Ndr_family :
mouse-ndr1 Mus musculus (Mouse) ndr1 ,
mouse-ndr2 Mus musculus (Mouse) ndrg2 protein (ndr2 protein),
mouse-ndr3 Mus musculus (Mouse) ndrg3 protein (ndr3 protein) ,
mouse-ndr4 Mus musculus (Mouse) NDRG4 ndrg4 protein mkiaa1180 .
Neuroligin :
mouse-1neur Mus musculus (Mouse) neuroligin 1, KIAA1070 clone MGC:7622 complete cds,
mouse-2neur Mus musculus (Mouse) neuroligin 2 (Nlgn2), mRNA,
mouse-3neur Mus musculus (Mouse) partial mRNA for neuroligin 3 protein ,
mouse-4neur Mus musculus (Mouse) neuroligin 4 .
NLS3-Tex30 :
mouse-Kansl3 Mus musculus (Mouse) Q8C0P9 4632411B12RIK serum inhibited-related protein homolog ,
mouse-Tex30 Mus musculus (Mouse) Tex30 Testis-expressed sequence 30 protein, C13orf27 homolog .
PAF-Acetylhydrolase :
mouse-paf2 Mus musculus (Mouse) similar to platelet-activating factor acetylhydrolase 2 (40 kda) ,
mouse-pafa Mus musculus plasma PAF acetylhydrolase .
Palmitoyl-protein_thioesterase :
mouse-ppt Mus musculus (Mouse) palmitoyl-protein thioesterase ,
mouse-PPT2 Mus musculus (Mouse) palmitoyl-protein thioesterase 2 .
Pancreatic_lipase :
mouse-1plip Mus musculus RIKEN Pancreatic lipase ,
mouse-1plrp Mus musculus (Mouse) pancreatic lipase related protein 1 ,
mouse-LIPR2 Mus musculus mRNA for cytotoxic T lymphocyte lipase .
PC-sterol_acyltransferase :
mouse-C87498 Mus musculus (Mouse) similar to LCAT-like lysophospholipase (llpl) ,
mouse-lcat Mus musculus mRNA for phosphatidylcholine-sterol acyltransferase ( lecithin: cholesterol acyltransferase) .
Pectinacetylesterase-Notum :
mouse-notum Mus musculus (Mouse) Protein notum homolog .
PGAP1 :
mouse-q3uuq7 Mus musculus (Mouse) gpi deacylase full insert sequence. (fragment) ,
mouse-srac1 Mus musculus (Mouse) Protein SERAC1 .
Phospholipase :
mouse-LIPH Mus musculus (Mouse) similar to lacrimal lipase ,
mouse-psplip Mus musculus Similar to phosphatidylserine-specific phospholipase A1alpha ,
mouse-f6yqt7 Mus musculus (Mouse). Lipase, member I .
PPase_methylesterase_euk :
mouse-PPME1 Mus musculus (Mouse) similar to protein phosphatase methylesterase-1 .
Prolylcarboxypeptidase :
mouse-dpp2 Mus musculus (Mouse) Dipeptidyl aminopeptidase II Dipeptidyl peptidase 7 ,
mouse-pcp Mus musculus (Mouse) prcp protein 2510048k03rik protein prolylcarboxypeptidase ,
mouse-tssp Mus musculus (Mouse) thymus-specific serine protease precursor (EC 3.4.-.-) ottmusp00000000643 .
S9N_PPCE_Peptidase_S9 :
mouse-ppce Mus musculus (Mouse) (PE) prolyl endopeptidase POP PREP .
S9N_PREPL_Peptidase_S9 :
mouse-Q8C167 Mus musculus (Mouse) PERLP unknown (protein for mgc:7980) mkiaa0436 .
SERHL :
mouse-SERHL Mus musculus (Mouse) serine hydrolase-like protein 0610008b10rik protein and isoforms shl-2 (1110019m09rik protein) .
Thioesterase :
mouse-AI607300 Mus musculus (Mouse) hydrolase (mch) SAST ,
mouse-FASN Mus musculus (Mouse) fatty acid synthase FAS oleoyl-[acyl-carrier-protein] hydrolase (EC 3.1.2.14) Thioesterase domain .
Thyroglobulin :
mouse-thyro Mus musculus thyroglobulin cDNA .
Valacyclovir-hydrolase :
mouse-bphl Mus musculus (Mouse) biphenyl hydrolase-like, breast epithelial mucin-assoc AG BPHL (mcnaa), Valacyclovir hydrolase 2010012d11 rik protein Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can
retrieve all strain data
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.Mus musculus molossinus:
N ,
E .
Molecular evidence
Database
No mutation No structure No kinetic
Sequence
Graphical view for this peptide sequence: mouse-LIPK Colored MSA for Acidic_Lipase (raw)
MWWLLATTCCVLLSGPIDGYKQESITNPEANMNISELISYWGYPYEKHDV
ITEDGYILGTYRIPHGKGCSRKTAPKAVVYLQHGLIASANNWICNLPNNS
LAFLLADSGYDVWLGNSRGNTWSRNHLRLSPKSPQYWAFSWDEMAKYDLP
ATVNLILEKSGQKQLFYVGHSQGTTIAFIAFSTNPELAKKIRLFFALAPV
ATVKYTRSPMKKLTTLSRKAVKVLFGDKMFSTHTWFEQFIATKVCNRKLF
HQLCSNFLFSLSGFDPQNLNMSRLDVYLSQSPAGTSVQNMLHWAQAVNSG
QLQAFDWGNPDQNMMHFNQLTPPVYNISKMRVPTAMWSGGQDVVADAKDT
KNLLPKIANLIYYKEIPHYNHMDFYLGQDAPQEVYGDLIRMIEESLQN
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
M W W L L A T T C C V L L S G P I D G Y K Q E S I T N P E A N M N I S E L I S Y W G Y P Y E K H D V I T E D G Y I L G T Y R I P H G K G C S R K T A P K A V V Y L Q H G L I A S A N N W I C N L P N N S L A F L L A D S G Y D V W L G N S R G N T W S R N H L R L S P K S P Q Y W A F S W D E M A K Y D L P A T V N L I L E K S G Q K Q L F Y V G H S Q G T T I A F I A F S T N P E L A K K I R L F F A L A P V A T V K Y T R S P M K K L T T L S R K A V K V L F G D K M F S T H T W F E Q F I A T K V C N R K L F H Q L C S N F L F S L S G F D P Q N L N M S R L D V Y L S Q S P A G T S V Q N M L H W A Q A V N S G Q L Q A F D W G N P D Q N M M H F N Q L T P P V Y N I S K M R V P T A M W S G G Q D V V A D A K D T K N L L P K I A N L I Y Y K E I P H Y N H M D F Y L G Q D A P Q E V Y G D L I R M I E E S L Q N no DNA
References
Title: Comparative studies of mammalian acid lipases: Evidence for a new gene family in mouse and rat (Lipo)
Holmes RS , Cox LA , Vandeberg JL
Ref: Comparative Biochemistry & Physiology Part D Genomics Proteomics, 5 :217, 2010 : PubMed Abstract ESTHER: Holmes_2010_Comp.Biochem.Physiol.Part.D.Genomics.Proteomics_5_217 PubMedSearch: Holmes 2010 Comp.Biochem.Physiol.Part.D.Genomics.Proteomics 5 217 PubMedID: 20598663 Gene_locus related to this paper: human-LIPF ,
human-LIPJ ,
human-LIPK ,
human-LIPM ,
human-LIPN ,
mouse-LIPK Abstract
At least six families of mammalian acid lipases (E.C. 3.1.1.-) catalyse the hydrolysis of triglycerides in the body, designated as LIPA (lysosomal), LIPF (gastric), LIPJ (testis) and LIPK, LIPM and LIPN (epidermal), which belong to the AB hydrolase superfamily. In this study, in silico methods were used to predict the amino acid sequences, secondary and tertiary structures, and gene locations for acid lipase genes and encoded proteins using data from several mammalian genome projects. Mammalian acid lipase genes were located within a gene cluster for each of the 8 mammalian genomes examined, including human (Homo sapiens), chimpanzee (Pons troglodytes), rhesus monkey (Macacca mulatta), mouse (Mus musculus), rat (Rattus norvegicus), cow (Bos taurus), horse (Equus caballus) and dog (Canis familaris), with each containing 9 coding exons. Human and mouse acid lipases shared 44-87% sequence identity and exhibited sequence alignments and identities for key amino acid residues and conservation of predicted secondary and tertiary structures with those previously reported for human gastric lipase (LIPF) (Roussel et al., 1999). Evidence for a new family of acid lipase genes is reported for mouse and rat genomes, designated as Lipo. Mouse acid lipase genes are subject to differential mRNA tissue expression, with Lipa showing wide tissue expression, while others have a more restricted tissue expression in the digestive tract (Lipf), salivary gland (Lipo) and epidermal tissues (Lipk, Lipm and Lipn). Phylogenetic analyses of the mammalian acid lipase gene families suggested that these genes are products of gene duplication events prior to eutherian mammalian evolution and derived from an ancestral vertebrate LIPA gene, which is present in the frog, Xenopus tropicalis.
         Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
Okazaki Y , Furuno M , Kasukawa T , Adachi J , Bono H , Kondo S , Nikaido I , Osato N , Saito R and Hayashizaki Y <127 more author(s)>
Okazaki Y , Furuno M , Kasukawa T , Adachi J , Bono H , Kondo S , Nikaido I , Osato N , Saito R , Suzuki H , Yamanaka I , Kiyosawa H , Yagi K , Tomaru Y , Hasegawa Y , Nogami A , Schonbach C , Gojobori T , Baldarelli R , Hill DP , Bult C , Hume DA , Quackenbush J , Schriml LM , Kanapin A , Matsuda H , Batalov S , Beisel KW , Blake JA , Bradt D , Brusic V , Chothia C , Corbani LE , Cousins S , Dalla E , Dragani TA , Fletcher CF , Forrest A , Frazer KS , Gaasterland T , Gariboldi M , Gissi C , Godzik A , Gough J , Grimmond S , Gustincich S , Hirokawa N , Jackson IJ , Jarvis ED , Kanai A , Kawaji H , Kawasawa Y , Kedzierski RM , King BL , Konagaya A , Kurochkin IV , Lee Y , Lenhard B , Lyons PA , Maglott DR , Maltais L , Marchionni L , McKenzie L , Miki H , Nagashima T , Numata K , Okido T , Pavan WJ , Pertea G , Pesole G , Petrovsky N , Pillai R , Pontius JU , Qi D , Ramachandran S , Ravasi T , Reed JC , Reed DJ , Reid J , Ring BZ , Ringwald M , Sandelin A , Schneider C , Semple CA , Setou M , Shimada K , Sultana R , Takenaka Y , Taylor MS , Teasdale RD , Tomita M , Verardo R , Wagner L , Wahlestedt C , Wang Y , Watanabe Y , Wells C , Wilming LG , Wynshaw-Boris A , Yanagisawa M , Yang I , Yang L , Yuan Z , Zavolan M , Zhu Y , Zimmer A , Carninci P , Hayatsu N , Hirozane-Kishikawa T , Konno H , Nakamura M , Sakazume N , Sato K , Shiraki T , Waki K , Kawai J , Aizawa K , Arakawa T , Fukuda S , Hara A , Hashizume W , Imotani K , Ishii Y , Itoh M , Kagawa I , Miyazaki A , Sakai K , Sasaki D , Shibata K , Shinagawa A , Yasunishi A , Yoshino M , Waterston R , Lander ES , Rogers J , Birney E , Hayashizaki Y (- 127)
Ref: Nature, 420 :563, 2002 : PubMed Abstract ESTHER: Okazaki_2002_Nature_420_563 PubMedSearch: Okazaki 2002 Nature 420 563 PubMedID: 12466851 Gene_locus related to this paper: mouse-1lipg ,
mouse-1llip ,
mouse-1plrp ,
mouse-3neur ,
mouse-ABH15 ,
mouse-abhd4 ,
mouse-abhd5 ,
mouse-Abhd8 ,
mouse-Abhd11 ,
mouse-abhda ,
mouse-acot4 ,
mouse-adcl4 ,
mouse-AI607300 ,
mouse-BAAT ,
mouse-bphl ,
mouse-C87498 ,
mouse-Ldah ,
mouse-Ces1d ,
mouse-Ces2e ,
mouse-CMBL ,
mouse-DGLB ,
mouse-dpp9 ,
mouse-ES10 ,
mouse-F135A ,
mouse-FASN ,
mouse-hslip ,
mouse-hyes ,
mouse-Kansl3 ,
mouse-LIPH ,
mouse-LIPK ,
mouse-lipli ,
mouse-LIPM ,
mouse-lypla1 ,
mouse-lypla2 ,
mouse-MEST ,
mouse-MGLL ,
mouse-ndr4 ,
mouse-OVCA2 ,
mouse-pafa ,
mouse-pcp ,
mouse-ppce ,
mouse-Ppgb ,
mouse-PPME1 ,
mouse-q3uuq7 ,
mouse-Q8BLF1 ,
mouse-ACOT6 ,
mouse-Q8C1A9 ,
mouse-Q9DAI6 ,
mouse-Q80UX8 ,
mouse-Q8BGG9 ,
mouse-Q8C167 ,
mouse-rbbp9 ,
mouse-SERHL ,
mouse-tssp Abstract
Only a small proportion of the mouse genome is transcribed into mature messenger RNA transcripts. There is an international collaborative effort to identify all full-length mRNA transcripts from the mouse, and to ensure that each is represented in a physical collection of clones. Here we report the manual annotation of 60,770 full-length mouse complementary DNA sequences. These are clustered into 33,409 'transcriptional units', contributing 90.1% of a newly established mouse transcriptome database. Of these transcriptional units, 4,258 are new protein-coding and 11,665 are new non-coding messages, indicating that non-coding RNA is a major component of the transcriptome. 41% of all transcriptional units showed evidence of alternative splicing. In protein-coding transcripts, 79% of splice variations altered the protein product. Whole-transcriptome analyses resulted in the identification of 2,431 sense-antisense pairs. The present work, completely supported by physical clones, provides the most comprehensive survey of a mammalian transcriptome so far, and is a valuable resource for functional genomics.
         Other Papers