Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-Lipg

Mus musculus (Mouse) Lipg endothelial lipase

Relationship
Family|Lipoprotein_Lipase
Block| L
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: AF118768, AK172101, AK153541
>3 UniProt links 4 more: Q9WVG5, Q3TA44, Q3U5K0
>3 UniProt links 4 more: Q9WVG5, Q3TA44, Q3U5K0
>3 Interpro links 4 more: Q9WVG5, Q3TA44, Q3U5K0
>3 Prodom links 4 more: Q9WVG5, Q3TA44, Q3U5K0
>3 Pfam links 4 more: Q9WVG5, Q3TA44, Q3U5K0
>3 PIRSF links 4 more: Q9WVG5, Q3TA44, Q3U5K0
>3 SUPERFAM links 4 more: Q9WVG5, Q3TA44, Q3U5K0
1 MGD : 1341803
2 ENSEMBL : Q9WVG5, ENSMUSG00000053846
Sequence
Graphical view for this peptide sequence: mouse-Lipg
Colored MSA for Lipoprotein_Lipase (raw)
MRNTVFLLGFWSVYCYFPAGSITTLRPQGSLRDEHHKPTGVPATARPSVA
FNIRTSKDPEQEGCNLSLGDSKLLENCGFNMTAKTFFIIHGWTMSGMFES
WLHKLVSALQMREKDANVVVVDWLPLAHQLYTDAVNNTRVVGQRVAGMLD
WLQEKEEFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFE
GVDINRRLSPDDADFVDVLHTYTLSFGLSIGIRMPVGHIDIYPNGGDFQP
GCGFNDVIGSFAYGTISEMVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
SRFKRGICLSCRKNRCNNIGYNAKKMRKKRNSKMYLKTRAGMPFKVYHYQ
LKVHMFSYNNSGDTQPTLYITLYGSNADSQNLPLEIVEKIELNATNTFLV
YTEEDLGDLLKMRLTWEGVAHSWCNLWNEFRNYLSQPSNPSRELYIRRIR
VKSGETQRKVTFCTQDPTKSSISPGQELWFHKCQDGWKMKNKTSPFVNLA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRNTVFLLGFWSVYCYFPAGSITTLRPQGSLRDEHHKPTGVPATARPSVA
FNIRTSKDPEQEGCNLSLGDSKLLENCGFNMTAKTFFIIHGWTMSGMFES
WLHKLVSALQMREKDANVVVVDWLPLAHQLYTDAVNNTRVVGQRVAGMLD
WLQEKEEFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFE
GVDINRRLSPDDADFVDVLHTYTLSFGLSIGIRMPVGHIDIYPNGGDFQP
GCGFNDVIGSFAYGTISEMVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
SRFKRGICLSCRKNRCNNIGYNAKKMRKKRNSKMYLKTRAGMPFKVYHYQ
LKVHMFSYNNSGDTQPTLYITLYGSNADSQNLPLEIVEKIELNATNTFLV
YTEEDLGDLLKMRLTWEGVAHSWCNLWNEFRNYLSQPSNPSRELYIRRIR
VKSGETQRKVTFCTQDPTKSSISPGQELWFHKCQDGWKMKNKTSPFVNLA


References
    Title: Endothelial lipase mediates efficient lipolysis of triglyceride-rich lipoproteins
    Khetarpal SA, Vitali C, Levin MG, Klarin D, Park J, Pampana A, Millar JS, Kuwano T, Sugasini D and Rader DJ <3 more author(s)>
    Ref: PLoS Genet, 17:e1009802, 2021 : PubMed

            

    Title: A comparison of whole-genome shotgun-derived mouse chromosome 16 and the human genome
    Mural RJ, Adams MD, Myers EW, Smith HO, Miklos GL, Wides R, Halpern A, Li PW, Sutton GG and Stephenson LD <169 more author(s)>
    Ref: Science, 296:1661, 2002 : PubMed

            

    Title: Cloning of a unique lipase from endothelial cells extends the lipase gene family.
    Hirata K, Dichek HL, Cioffi JA, Choi SY, Leeper NJ, Quintana L, Kronmal GS, Cooper AD, Quertermous T
    Ref: Journal of Biological Chemistry, 274:14170, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer