arath-F16B3.4

Arabidopsis thaliana (Mouse-ear cress) F16B3.4 At3g02410 Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2

Comment

"There is a difference in exons in Q1PET6 and Q9M899"

Relationship

Family : BD-FAE

Block : H

Position in NCBI Life Tree : Arabidopsis thaliana

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MQLSPERCRPMSENREAWSANSEEMELLHGSNRLSSPEHV
RRRVSGNSSE DGSPRICRQQSFGRDIGHAAAETYLITRL
SFNLLGYLGVGYRWITRLLAL ACYAMLLMPGFLQVAYLY
FFSSQVRRSIVYGGHPRNRLDLYIPPTSDGLK PVVVFVT
GGAWIIGYKAWGSLLGLQLAERDIIVACLDYRNFPQGTIS
DMV SDAAQGISFVCNNISAFGGDPNRIYLMGQSAGAHIS
SCALFEQAIKESRG ESISWSVSQIKAYFGLSGGYNLFNL
VEHFHNRGLYRSIFLSIMEGEESFK QFSPEVRLKDLNVR
KAAALLPHIILFHGSADYSIPPEASKTFTDALQAAE VKA
ELVMYKGKTHTDLFLQDPLRGGKDELFDHIVSMIHADDSD
ALRNDAV APPRKRLVPEFLLKLAGRVSPF

References

Title : Characterization, sub-cellular localization and expression profiling of the isoprenylcysteine methylesterase gene family in Arabidopsis thaliana - Lan_2010_BMC.Plant.Biol_10_212
Author(s) : Lan P , Li W , Wang H , Ma W
Ref : BMC Plant Biol , 10 :212 , 2010
Abstract : Lan_2010_BMC.Plant.Biol_10_212
ESTHER : Lan_2010_BMC.Plant.Biol_10_212
PubMedSearch : Lan_2010_BMC.Plant.Biol_10_212
PubMedID: 20868530
Gene_locus related to this paper: arath-F14F8.240 , arath-F16B3.4

Title : Isoprenylcysteine methylation and demethylation regulate abscisic acid signaling in Arabidopsis - Huizinga_2008_Plant.Cell_20_2714
Author(s) : Huizinga DH , Omosegbon O , Omery B , Crowell DN
Ref : Plant Cell , 20 :2714 , 2008
Abstract : Huizinga_2008_Plant.Cell_20_2714
ESTHER : Huizinga_2008_Plant.Cell_20_2714
PubMedSearch : Huizinga_2008_Plant.Cell_20_2714
PubMedID: 18957507
Gene_locus related to this paper: arath-F14F8.240 , arath-F16B3.4

Title : Prenylcysteine methylesterase in Arabidopsis thaliana - Deem_2006_Gene_380_159
Author(s) : Deem AK , Bultema RL , Crowell DN
Ref : Gene , 380 :159 , 2006
Abstract : Deem_2006_Gene_380_159
ESTHER : Deem_2006_Gene_380_159
PubMedSearch : Deem_2006_Gene_380_159
PubMedID: 16870359
Gene_locus related to this paper: arath-F14F8.240 , arath-F16B3.4

Title : Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana - Salanoubat_2000_Nature_408_820
Author(s) : Salanoubat M , Lemcke K , Rieger M , Ansorge W , Unseld M , Fartmann B , Valle G , Blocker H , Perez-Alonso M , Obermaier B , Delseny M , Boutry M , Grivell LA , Mache R , Puigdomenech P , de Simone V , Choisne N , Artiguenave F , Robert C , Brottier P , Wincker P , Cattolico L , Weissenbach J , Saurin W , Quetier F , Schafer M , Muller-Auer S , Gabel C , Fuchs M , Benes V , Wurmbach E , Drzonek H , Erfle H , Jordan N , Bangert S , Wiedelmann R , Kranz H , Voss H , Holland R , Brandt P , Nyakatura G , Vezzi A , D'Angelo M , Pallavicini A , Toppo S , Simionati B , Conrad A , Hornischer K , Kauer G , Lohnert TH , Nordsiek G , Reichelt J , Scharfe M , Schon O , Bargues M , Terol J , Climent J , Navarro P , Collado C , Perez-Perez A , Ottenwalder B , Duchemin D , Cooke R , Laudie M , Berger-Llauro C , Purnelle B , Masuy D , de Haan M , Maarse AC , Alcaraz JP , Cottet A , Casacuberta E , Monfort A , Argiriou A , Flores M , Liguori R , Vitale D , Mannhaupt G , Haase D , Schoof H , Rudd S , Zaccaria P , Mewes HW , Mayer KF , Kaul S , Town CD , Koo HL , Tallon LJ , Jenkins J , Rooney T , Rizzo M , Walts A , Utterback T , Fujii CY , Shea TP , Creasy TH , Haas B , Maiti R , Wu D , Peterson J , Van Aken S , Pai G , Militscher J , Sellers P , Gill JE , Feldblyum TV , Preuss D , Lin X , Nierman WC , Salzberg SL , White O , Venter JC , Fraser CM , Kaneko T , Nakamura Y , Sato S , Kato T , Asamizu E , Sasamoto S , Kimura T , Idesawa K , Kawashima K , Kishida Y , Kiyokawa C , Kohara M , Matsumoto M , Matsuno A , Muraki A , Nakayama S , Nakazaki N , Shinpo S , Takeuchi C , Wada T , Watanabe A , Yamada M , Yasuda M , Tabata S
Ref : Nature , 408 :820 , 2000
Abstract : Salanoubat_2000_Nature_408_820
ESTHER : Salanoubat_2000_Nature_408_820
PubMedSearch : Salanoubat_2000_Nature_408_820
PubMedID: 11130713
Gene_locus related to this paper: arath-MES17 , arath-AT3G12150 , arath-At3g61680 , arath-AT3g62590 , arath-CXE12 , arath-eds1 , arath-SCP25 , arath-F1P2.110 , arath-F1P2.140 , arath-F11F8.28 , arath-F14D17.80 , arath-F16B3.4 , arath-SCP27 , arath-At3g50790 , arath-At3g05600 , arath-PAD4 , arath-At3g51000 , arath-SCP16 , arath-gid1 , arath-GID1B , arath-Q9LUG8 , arath-Q84JS1 , arath-Q9SFF6 , arath-q9m236 , arath-q9sr22 , arath-q9sr23 , arath-SCP7 , arath-SCP14 , arath-SCP15 , arath-SCP17 , arath-SCP36 , arath-SCP37 , arath-SCP39 , arath-SCP40 , arath-SCP49 , arath-T19F11.2