Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: anoga-q7q8m4

Anopheles gambiae (African malaria mosquito); Anopheles quadriannulatus (Mosquito); A. arabiensis; A. merus; A. melas; A.funestus; A.epiroticus; A.coluzzii; A.culicifacies; A.stephensi; A.sinensis; A.atroparvus; A.farauti; A.dirus; A.albimanus AGAP008542-PA

Comment
other strains: Anopheles gambiae (African malaria mosquito); Anopheles quadriannulatus (Mosquito); Anopheles arabiensis; Anopheles merus Here sequence from Anopheles quadriannulatus; Anopheles melas; Anopheles funestus; Anopheles epiroticus; Anopheles coluzzii; Anopheles culicifacies; Anopheles stephensi; Anopheles sinensis; Anopheles atroparvus; Anopheles farauti; Anopheles dirus; Anopheles albimanus


Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Anopheles gambiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Nematocera: N E > Culicomorpha: N E > Culicoidea: N E > Culicidae: N E > Anophelinae: N E > Anopheles [genus]: N E > Cellia: N E > Pyretophorus: N E > gambiae species complex: N E > Anopheles gambiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AAAB01008944, EAA10285, XP_314653
>3 UniProt links 1 more: Q7Q8M4, A0A182WRS9, A0A182IBS3
>3 UniProt links 11 more: Q7Q8M4, A0A182WRS9, A0A182IBS3
>3 Interpro links 11 more: Q7Q8M4, A0A182WRS9, A0A182IBS3
>3 Prodom links 11 more: Q7Q8M4, A0A182WRS9, A0A182IBS3
>3 Pfam links 11 more: Q7Q8M4, A0A182WRS9, A0A182IBS3
>3 PIRSF links 11 more: Q7Q8M4, A0A182WRS9, A0A182IBS3
>3 SUPERFAM links 11 more: Q7Q8M4, A0A182WRS9, A0A182IBS3
Sequence
Graphical view for this peptide sequence: anoga-q7q8m4
Colored MSA for abh_upf0017 (raw)
YIPTRLWGFSGHIQTIIHSIVGRVKCPWPLGERVYLALTDGSTLTYDLYQ
PLITTVEDDITVAICPGIGNSSESVYIRTFVHYAQCHGYRCAVLNHIGVL
DSVQVTSSRIFTYGHTDDYSAMINSLLKKYPTTNIVSVGFSLGGNLISKY
LGEAKRPANIIGGVSICQGYNAVVATQWLLKWQNFHRFYLYVLTENVKSI
IMKHRHVLLSDDIKQRYQLNERDIAAAATLPELDEAYTRRVHQFPTVKDM
YSWSSSLNYLANIQRPMVFVNARDDPLVPDNLLEPVKQFASAHNQTMYVE
LANGGHLGFYEGGLVYPNPVTWLDRAVVSLIGGIVMSHNDLLVAKRTASS
SMVI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

YIPTRLWGFSGHIQTIIHSIVGRVKCPWPLGERVYLALTDGSTLTYDLYQ
PLITTVEDDITVAICPGIGNSSESVYIRTFVHYAQCHGYRCAVLNHIGVL
DSVQVTSSRIFTYGHTDDYSAMINSLLKKYPTTNIVSVGFSLGGNLISKY
LGEAKRPANIIGGVSICQGYNAVVATQWLLKWQNFHRFYLYVLTENVKSI
IMKHRHVLLSDDIKQRYQLNERDIAAAATLPELDEAYTRRVHQFPTVKDM
YSWSSSLNYLANIQRPMVFVNARDDPLVPDNLLEPVKQFASAHNQTMYVE
LANGGHLGFYEGGLVYPNPVTWLDRAVVSLIGGIVMSHNDLLVAKRTASS
SMVI


Reference
    Title: The genome sequence of the malaria mosquito Anopheles gambiae
    Holt RA, Subramanian GM, Halpern A, Sutton GG, Charlab R, Nusskern DR, Wincker P, Clark AG, Ribeiro JM and Hoffman SL <113 more author(s)>
    Ref: Science, 298:129, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer