aspfu-q4wg73

 
Neosartorya fumigata (Aspergillus fumigatus) Lipase, putative

Comment
Other strains: Neosartorya fumigata (strains ATCC MYA-4609 / Af293 / CBS 101355 / FGS A1100; CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)


Relationship
Family Canar_LipB
Block L
Neosartorya fumigata position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6IDY: Crystal structure of Aspergillus fumigatus lipase B
No kinetic



2 Genbank : AAHF01000009, DS499601
2 UniProt : Q4WG73, B0YCB0
1 Structure : 6IDY
2 UniProtTrembl : Q4WG73, B0YCB0
2 Interpro : Q4WG73, B0YCB0
2 Prodom : Q4WG73, B0YCB0
2 Pfam : Q4WG73, B0YCB0
2 PIRSF : Q4WG73, B0YCB0
2 SUPERFAM : Q4WG73, B0YCB0
2 QuickSwissBlast : Q4WG73, B0YCB0
 
Sequence
Graphical view for this peptide sequence: aspfu-q4wg73
Colored MSA for Canar_LipB (raw)
MRWSSLLKAAVLYRAILSPLVSGAVIPRGAVPVASDLSLVSILSSAANDS
SIESEARSIASLIASEIVSKIGKTEFSRSTKDAKSVQEAFDKIQSIFADG
TPDFLKMTREILTVGLIPADIVSFLNGYLNLDLNSIHNRNPSPKGQAIYP
VKAPGDARYSVAENALRAAIHIPASFGYGKNGKKPVILVPGTATPAGTTY
YFNFGKLGSAADADVVWLNIPQASLNDVQINSEYVAYAINYISAISESNV
AVLSWSQGGLDTQWALKYWPSTRKVVDDFIAISPDFHGTVMRSLVCPWLA
ALACTPSLWQQGWNTEFIRTLRGGGGDSAYVPTTTIYSTFDEIVQPMSGS
QASAILSDSRAVGVSNNHLQTICGGKPAGGVYTHEGVLYNPLAWALAVDA
LSHDGPGDPSRLDLDVVCGRVLPPQLGLDDLLGTEGLLLIALAEVLAYKP
KTFGEPAIASYAH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRWSSLLKAAVLYRAILSPLVSGAVIPRGAVPVASDLSLVSILSSAANDS
SIESEARSIASLIASEIVSKIGKTEFSRSTKDAKSVQEAFDKIQSIFADG
TPDFLKMTREILTVGLIPADIVSFLNGYLNLDLNSIHNRNPSPKGQAIYP
VKAPGDARYSVAENALRAAIHIPASFGYGKNGKKPVILVPGTATPAGTTY
YFNFGKLGSAADADVVWLNIPQASLNDVQINSEYVAYAINYISAISESNV
AVLSWSQGGLDTQWALKYWPSTRKVVDDFIAISPDFHGTVMRSLVCPWLA
ALACTPSLWQQGWNTEFIRTLRGGGGDSAYVPTTTIYSTFDEIVQPMSGS
QASAILSDSRAVGVSNNHLQTICGGKPAGGVYTHEGVLYNPLAWALAVDA
LSHDGPGDPSRLDLDVVCGRVLPPQLGLDDLLGTEGLLLIALAEVLAYKP
KTFGEPAIASYAH

no DNA




References
    Title: Structure and characterization of Aspergillus fumigatus lipase B with a unique, oversized regulatory subdomain
    Huang W, Lan D, Popowicz GM, Zak KM, Zhao Z, Yuan H, Yang B, Wang Y
    Ref: Febs J, 286:2366, 2019 : PubMed

            

    Title: Genomic islands in the pathogenic filamentous fungus Aspergillus fumigatus
    Fedorova ND, Khaldi N, Joardar VS, Maiti R, Amedeo P, Anderson MJ, Crabtree J, Silva JC, Badger JH and Nierman WC <29 more author(s)>
    Ref: PLoS Genet, 4:e1000046, 2008 : PubMed

            

    Title: Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus
    Nierman WC, Pain A, Anderson MJ, Wortman JR, Kim HS, Arroyo J, Berriman M, Abe K, Archer DB and Denning DW <87 more author(s)>
    Ref: Nature, 438:1151, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer