bacsu-PPSE

 
Bacillus subtilis peptide synthetase orf5 Thioesterase domain

Comment
Other strains: Bacillus subtilis (168; BSn5; XF-1)


Relationship
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : Z99113, Y13917, Z34883
2 UniProt : O31827, P94460
>3 UniProtTrembl links 4 more: O31827, P94460, A0A060PP35
>3 Interpro links 4 more: O31827, P94460, A0A060PP35
>3 Prodom links 4 more: O31827, P94460, A0A060PP35
>3 Pfam links 4 more: O31827, P94460, A0A060PP35
>3 PIRSF links 4 more: O31827, P94460, A0A060PP35
>3 SUPERFAM links 4 more: O31827, P94460, A0A060PP35
>3 QuickSwissBlast links 4 more: O31827, P94460, A0A060PP35
 
Sequence
Graphical view for this peptide sequence: bacsu-PPSE
Colored MSA for Thioesterase (raw)
QNLFCFPPISGFGIYFKDLALLLNEKAAVYGFHFIEQDTRIEQYVNCMTD
IQPEGPYVLLGYSAGGNLAFEVAQAMERKGLEVSDFIIVDAYLKEQPLPI
DTGNDESAAYLPEAVREKVMKKKRNYQEYWAQLLNEGHIKASIHFIEAGI
HPETSGHTGLTKWEGACGNYSEYTGFGAHKDMLEGTYAEKNADIILDILE
KITSNQVILHKR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

QNLFCFPPISGFGIYFKDLALLLNEKAAVYGFHFIEQDTRIEQYVNCMTD
IQPEGPYVLLGYSAGGNLAFEVAQAMERKGLEVSDFIIVDAYLKEQPLPI
DTGNDESAAYLPEAVREKVMKKKRNYQEYWAQLLNEGHIKASIHFIEAGI
HPETSGHTGLTKWEGACGNYSEYTGFGAHKDMLEGTYAEKNADIILDILE
KITSNQVILHKR

no DNA




References
2 more
    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            

    Title: Sequence completion, identification and definition of the fengycin operon in Bacillus subtilis 168
    Tosato V, Albertini AM, Zotti M, Sonda S, Bruschi CV
    Ref: Microbiology, 143 ( Pt 11):3443, 1997 : PubMed

            

    Title: A putative new peptide synthase operon in Bacillus subtilis: partial characterization.
    Tognoni A, Franchi E, Magistrelli C, Colombo E, Cosmina P, Grandi G
    Ref: Microbiology, 141:645, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer