bacsu-YTPA

 
Bacillus subtilis Bacilysocin biosynthesis protein ytpA

Comment
Other strains: Bacillus subtilis subsp. natto BEST195; subsp. spizizenii (strains ATCC 23059 / NRRL B-1447 / W23; ATCC 6633 ) BSn5, Geobacillus sp. (strain Y4.1MC1)


Relationship
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 5 more: AF008220, Z99119, NC_000964
3 UniProt : O34705, D4G0D3, E0TY74
3 UniProtTrembl : O34705, D4G0D3, E0TY74
3 Interpro : O34705, D4G0D3, E0TY74
3 Prodom : O34705, D4G0D3, E0TY74
3 Pfam : O34705, D4G0D3, E0TY74
3 PIRSF : O34705, D4G0D3, E0TY74
3 SUPERFAM : O34705, D4G0D3, E0TY74
3 QuickSwissBlast : O34705, D4G0D3, E0TY74
 
Sequence
Graphical view for this peptide sequence: bacsu-YTPA
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MWTWKADRPVAVIVIIHGASEYHGRYKWLIEMWRSSGYHVVMGDLPGQGT
TTRARGHIRSFQEYIDEVDAWIDKARTFDLPVFLLGHSMGGLVAIEWVKQ
QRNPRITGIILSSPCLGLQIKVNKALDLASKGLNVIAPSLKVDSGLSIDM
ATRNEDVIEADQNDSLYVRKVSVRWYRELLKTIESAMVPTEAFLKVPLLV
MQAGDDKLVDKTMVIKWFNGVASHNKAYREWEGLYHEIFNEPEREDVFKA
ARAFTDQYI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWTWKADRPVAVIVIIHGASEYHGRYKWLIEMWRSSGYHVVMGDLPGQGT
TTRARGHIRSFQEYIDEVDAWIDKARTFDLPVFLLGHSMGGLVAIEWVKQ
QRNPRITGIILSSPCLGLQIKVNKALDLASKGLNVIAPSLKVDSGLSIDM
ATRNEDVIEADQNDSLYVRKVSVRWYRELLKTIESAMVPTEAFLKVPLLV
MQAGDDKLVDKTMVIKWFNGVASHNKAYREWEGLYHEIFNEPEREDVFKA
ARAFTDQYI

no DNA




References
2 more
    Title: Bacilysocin, a novel phospholipid antibiotic produced by Bacillus subtilis 168
    Tamehiro N, Okamoto-Hosoya Y, Okamoto S, Ubukata M, Hamada M, Naganawa H, Ochi K
    Ref: Antimicrobial Agents & Chemotherapy, 46:315, 2002 : PubMed

            

    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            

    Title: Sequencing and functional annotation of the Bacillus subtilis genes in the 200 kb rrnB-dnaB region.
    Lapidus A, Galleron N, Sorokin A, Ehrlich SD
    Ref: Microbiology, 143:3431, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer