Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: burma-q62mq7

Burkholderia mallei (Pseudomonas mallei), Burkholderia pseudomallei (Pseudomonas pseudomallei), Burkholderia thailandensis), esterase, putative

Comment
Other strains:Burkholderia mallei (Pseudomonas mallei) (strain ATCC 23344; NCTC 10247; NCTC 10229; SAVP1) Burkholderia pseudomallei (Pseudomonas pseudomallei) (strains 1710b; MSHR305; K96243; 1026b; 1710a; 1106b; MSHR346; 1106a; MSHR6137; MSHR520; MSHR146; MSHR511; NAU20B-16; BPC006; 668) Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276)


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Burkholderia mallei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > pseudomallei group: N E > Burkholderia mallei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: burma-q62mq7
Colored MSA for Hormone-sensitive_lipase_like (raw)
MSWQSKVACWLLRRQFRPETLRPVIDPARARRLTKLRVRVPRRAPAGWRL
RERYGPAAAPLRGEWLERADVAPGRAQRGRMLLYFHGGGYYFCSPQTHRP
LVFALTKLAGVRSFSLDYRLAPEHPFPAALDDALAAYRQLVSAGTPPESI
VFGGDSAGGGLALATLVALRDAGDPLPSGAVLFSPWTDLAATGDTLRTHD
GLDPMFAGAALGRAARLYLGDTPGTHPHASPLYADFAGLPPLFIQAGSTE
VLLDDSRRVAEKARAAGVHVELEIWPQMPHVWQIFVPFVPESARALERAA
AFVRRTAVERATQRTADASIA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSWQSKVACWLLRRQFRPETLRPVIDPARARRLTKLRVRVPRRAPAGWRL
RERYGPAAAPLRGEWLERADVAPGRAQRGRMLLYFHGGGYYFCSPQTHRP
LVFALTKLAGVRSFSLDYRLAPEHPFPAALDDALAAYRQLVSAGTPPESI
VFGGDSAGGGLALATLVALRDAGDPLPSGAVLFSPWTDLAATGDTLRTHD
GLDPMFAGAALGRAARLYLGDTPGTHPHASPLYADFAGLPPLFIQAGSTE
VLLDDSRRVAEKARAAGVHVELEIWPQMPHVWQIFVPFVPESARALERAA
AFVRRTAVERATQRTADASIA


References
2 more
    Title: Complete Genome Sequence of the Encephalomyelitic Burkholderia pseudomallei Strain MSHR305
    Stone JK, Johnson SL, Bruce DC, Detter JC, Mayo M, Currie BJ, Gelhaus HC, Keim P, Tuanyok A
    Ref: Genome Announc, 1:e00656, 2013 : PubMed

            

    Title: Genomic plasticity of the causative agent of melioidosis, Burkholderia pseudomallei
    Holden MT, Titball RW, Peacock SJ, Cerdeno-Tarraga AM, Atkins T, Crossman LC, Pitt T, Churcher C, Mungall K and Parkhill J <38 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:14240, 2004 : PubMed

            

    Title: Structural flexibility in the Burkholderia mallei genome
    Nierman WC, DeShazer D, Kim HS, Tettelin H, Nelson KE, Feldblyum T, Ulrich RL, Ronning CM, Brinkac LM and Fraser CM <23 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:14246, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer