human-AADACL2

 
Homo sapiens (Human) similar to arylacetamide deacetylase (aadac)

Comment
Arylacetamide deacetylase-like 2


Relationship
Block H
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: BC065724, BX647585, AC068647
1 UniProt : Q6P093
1 UniProtTrembl : Q6P093
1 Interpro : Q6P093
1 Prodom : Q6P093
1 Pfam : Q6P093
1 PIRSF : Q6P093
1 SUPERFAM : Q6P093
1 QuickSwissBlast : Q6P093
1 EntrezGene : 344752
1 SNP : 344752
1 UniGene : 144710
1 HUGO HGNC : 24427
1 Ensembl : ENSG00000197953
 
Sequence
Graphical view for this peptide sequence: human-AADACL2
Colored MSA for Arylacetamide_deacetylase (raw)
MPDNIEESWKIMALDAIAKTCTFTAMCFENMRIMRYEEFISMIFRLDYTQ
PLSDEYITVTDTTFVDIPVRLYLPKRKSETRRRAVIYFHGGGFCFGSSKQ
RAFDFLNRWTANTLDAVVVGVDYRLAPQHHFPAQFEDGLAAVKFFLLEKI
LTKYGVDPTRICISGDSSGGNLATAVTQQVQNDAEIKHKIKMQVLLYPGL
QITDSYLPSHRENEHGIVLTRDVAIKLVSLYFTKDEALPWAMRRNQHMPL
ESRHLFKFVNWSILLPEKYRKDYVYTEPILGGLSYSLPGLTDSRALPLLA
NDSQLQNLPLTYILTCQHDLLRDDGLMYVTRLRNVGVQVVHEHIEDGIHG
ALSFMTSPFYLRLGLRIRDMYVSWLDKNL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPDNIEESWKIMALDAIAKTCTFTAMCFENMRIMRYEEFISMIFRLDYTQ
PLSDEYITVTDTTFVDIPVRLYLPKRKSETRRRAVIYFHGGGFCFGSSKQ
RAFDFLNRWTANTLDAVVVGVDYRLAPQHHFPAQFEDGLAAVKFFLLEKI
LTKYGVDPTRICISGDSSGGNLATAVTQQVQNDAEIKHKIKMQVLLYPGL
QITDSYLPSHRENEHGIVLTRDVAIKLVSLYFTKDEALPWAMRRNQHMPL
ESRHLFKFVNWSILLPEKYRKDYVYTEPILGGLSYSLPGLTDSRALPLLA
NDSQLQNLPLTYILTCQHDLLRDDGLMYVTRLRNVGVQVVHEHIEDGIHG
ALSFMTSPFYLRLGLRIRDMYVSWLDKNL

no DNA




Reference
    Title: The DNA sequence, annotation and analysis of human chromosome 3
    Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A and Gibbs RA <100 more author(s)>
    Ref: Nature, 440:1194, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer