mouse-LIPH

 
Mus musculus (Mouse) similar to lacrimal lipase

Relationship
Block L
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 3 more: AK048150, BC037489, AK162492
1 UniProtTrembl : Q8CIV3
1 Interpro : Q8CIV3
1 Prodom : Q8CIV3
1 Pfam : Q8CIV3
1 PIRSF : Q8CIV3
1 SUPERFAM : Q8CIV3
1 QuickSwissBlast : Q8CIV3
1 MGD : 2388029
1 ENSEMBL : ENSMUSG00000044626
 
Sequence
Graphical view for this peptide sequence: mouse-LIPH
Colored MSA for Phospholipase (raw)
MLRLCFFISFMCLVKSDTDETCPSFTRLSFHSAVVGTGLSVRLMLYTQRD
QTCAQIINSTALGSLNVTKKTTFIIHGFRPTGSPPVWIEELVQSLISVQE
MNVVVVDWNRGATTVIYPHASSKTRQVASILKEFIDQMLVKGASLDNIYM
IGVSLGAHIAGFVGESYEGKLGRVTGLDPAGPLFNGRPPEERLDPSDALF
VDVIHSDTDGYKEALGHIDFYPNGGLDQPGCPKTIFGGIKYFKCDHQMSV
YLYLASLQNNCSITAYPCDSYRDYRNGKCVSCGAGQIVPCPRVGYYADSW
KEYLWDRDPPMTKAFFDTAETKPYCMYHYFVDIVSWNKSVRRGFITIKLR
GEDGNITESKIDHEPSAFEKYHQVSLLARFNRDLDKVAEISLLFSTGSVV
GPKYKLRVLQMKLRSLAHPDRPHLCRYDLVLMENVETSFQPILCSQQQM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLRLCFFISFMCLVKSDTDETCPSFTRLSFHSAVVGTGLSVRLMLYTQRD
QTCAQIINSTALGSLNVTKKTTFIIHGFRPTGSPPVWIEELVQSLISVQE
MNVVVVDWNRGATTVIYPHASSKTRQVASILKEFIDQMLVKGASLDNIYM
IGVSLGAHIAGFVGESYEGKLGRVTGLDPAGPLFNGRPPEERLDPSDALF
VDVIHSDTDGYKEALGHIDFYPNGGLDQPGCPKTIFGGIKYFKCDHQMSV
YLYLASLQNNCSITAYPCDSYRDYRNGKCVSCGAGQIVPCPRVGYYADSW
KEYLWDRDPPMTKAFFDTAETKPYCMYHYFVDIVSWNKSVRRGFITIKLR
GEDGNITESKIDHEPSAFEKYHQVSLLARFNRDLDKVAEISLLFSTGSVV
GPKYKLRVLQMKLRSLAHPDRPHLCRYDLVLMENVETSFQPILCSQQQM

no DNA




References
    Title: Lipase H, a new member of the triglyceride lipase family synthesized by the intestine
    Jin W, Broedl UC, Monajemi H, Glick JM, Rader DJ
    Ref: Genomics, 80:268, 2002 : PubMed

            

    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer