Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: neime-NMB0276

Neisseria meningitidis, Neisseria gonorrhoeae, Neisseria lactamica, Neisseria cinerea, hypothetical protein nmb0276

Comment
Other strains: Neisseria meningitidis (serogroup A (strain WUE 2594); serogroup B (strains M04-240196; M01-240355; G2136; serotype 15 (strain H44/76) M01-240149; NZ-05/33; alpha710); alpha153; serogroup C / serotype 2a (strain ATCC 700532); alpha275; alpha14; serogroup C (strains 8013; 053442); OX99.30304; 961-5945; M13399; ATCC 13091; M6190; ES14902; CU385; M01-240013; M0579; N1568 ) Neisseria gonorrhoeae (strain NCCP11945; PID1; SK-92-679; PID18; FA19; SK-93-1035; MS11; 1291; PID332; ATCC 700825 / FA 1090; 35/02; DGI2; F62; TCDC-NG08107) Neisseria lactamica (ATCC 23970; Y92-1009; 020-06) Neisseria cinerea ATCC 14685; Neisseria polysaccharea ATCC 43768


Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Neisseria meningitidis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Neisseriales: N E > Neisseriaceae: N E > Neisseria: N E > Neisseria meningitidis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 43 more: AE002384, CP001050, EQ972919
>3 UniProt links 12 more: B4RPF0, Q5F647, C6SFR1
>3 UniProt links 13 more: Q9K191, B4RPF0, Q5F647
>3 Interpro links 13 more: Q9K191, B4RPF0, Q5F647
>3 Prodom links 13 more: Q9K191, B4RPF0, Q5F647
>3 Pfam links 13 more: Q9K191, B4RPF0, Q5F647
>3 PIRSF links 13 more: Q9K191, B4RPF0, Q5F647
>3 SUPERFAM links 13 more: Q9K191, B4RPF0, Q5F647
Sequence
Graphical view for this peptide sequence: neime-NMB0276
Colored MSA for abh_upf0017 (raw)
MILTPPDTPFFLRNGNADTIAAKFLQRPAPAYRRELLPDSTGKTKVAYDF
SDGISPDAPLVVLFHGLEGSSRSHYAVELMLAVRDRGWHGVVVHFRSCGG
IANTAPVFYHLGDTAEIAFTLDTFAARYREIYAVGVSLGGNALAKYLGEQ
GKKALPQAAAVISAPVDAEAAGRRFDSGITRLLYTRYFLRTLIPKAKSLQ
GFQTAFAAGCKTLGEFDDRFTAPLHGFADRHDYYRQTSCKPLLKHVAKPL
LLLNAVNDPFLPPEALPRADEVSEAVTLFQPAYGGHVGFVSSTGGRLHLQ
WLPQTVLSYFDSFRTNRR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MILTPPDTPFFLRNGNADTIAAKFLQRPAPAYRRELLPDSTGKTKVAYDF
SDGISPDAPLVVLFHGLEGSSRSHYAVELMLAVRDRGWHGVVVHFRSCGG
IANTAPVFYHLGDTAEIAFTLDTFAARYREIYAVGVSLGGNALAKYLGEQ
GKKALPQAAAVISAPVDAEAAGRRFDSGITRLLYTRYFLRTLIPKAKSLQ
GFQTAFAAGCKTLGEFDDRFTAPLHGFADRHDYYRQTSCKPLLKHVAKPL
LLLNAVNDPFLPPEALPRADEVSEAVTLFQPAYGGHVGFVSSTGGRLHLQ
WLPQTVLSYFDSFRTNRR


References
10 more
    Title: Complete genome sequence of Neisseria gonorrhoeae NCCP11945
    Chung GT, Yoo JS, Oh HB, Lee YS, Cha SH, Kim SJ, Yoo CK
    Ref: Journal of Bacteriology, 190:6035, 2008 : PubMed

            

    Title: Complete DNA sequence of a serogroup A strain of Neisseria meningitidis Z2491
    Parkhill J, Achtman M, James KD, Bentley SD, Churcher C, Klee SR, Morelli G, Basham D, Brown D and Barrell BG <18 more author(s)>
    Ref: Nature, 404:502, 2000 : PubMed

            

    Title: Complete genome sequence of Neisseria meningitidis serogroup B strain MC58
    Tettelin H, Saunders NJ, Heidelberg J, Jeffries AC, Nelson KE, Eisen JA, Ketchum KA, Hood DW, Peden JF and Venter JC <32 more author(s)>
    Ref: Science, 287:1809, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer