Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysa-Q7F959

Oryza sativa (Rice) osjnba0079f16.20 protein (osjnba0094p09.4 protein)

Relationship
Family|Acidic_Lipase
Block| X
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AL731625, AL731614, CM000129
3 UniProt : Q7F959, Q7X8S9, A2XRD4
3 UniProt : Q7F959, Q7X8S9, A2XRD4
3 Interpro : Q7F959, Q7X8S9, A2XRD4
3 Prodom : Q7F959, Q7X8S9, A2XRD4
3 Pfam : Q7F959, Q7X8S9, A2XRD4
3 PIRSF : Q7F959, Q7X8S9, A2XRD4
3 SUPERFAM : Q7F959, Q7X8S9, A2XRD4
Sequence
Graphical view for this peptide sequence: orysa-Q7F959
Colored MSA for Acidic_Lipase (raw)
MPGGGNRCGLQPISLLQALATIILAVAAAAAAARPAPIAGTSSSTSRVAA
ANGTCQSRVAPFGYACEEHTVTTEDGYILSLQRIPSGRGETAAGGGGGGK
VPVLLQHGLMMDGVTWLMNSPNESLGYILADNGYDVWIANSRGTVYSRHH
TSLVSSDSAYWNWSWDELSSKDLSAEVQYVYSQAGQQKMHYVGHSLGTLI
ALAALSDQQQQIGMLRSAGLLSPIAFLDKMSSPLARAAADVFLAEALYWL
GLSEFDPTGEYVHSLVTDICKQPGIDCYNLMSAFTGDNCCLDNSSVQVFL
AHEPQATATKNMIHLAQMIRGGTIAKYDYGNAGDNREHYGQATPPAYDVT
AIPGDFPLFLSYGGRDSLSDVQDVSRPLRALGQSHSRDGDKLTVQYLADY
AHADFVMARNAGERVYAPLMAFFTLQEK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPGGGNRCGLQPISLLQALATIILAVAAAAAAARPAPIAGTSSSTSRVAA
ANGTCQSRVAPFGYACEEHTVTTEDGYILSLQRIPSGRGETAAGGGGGGK
VPVLLQHGLMMDGVTWLMNSPNESLGYILADNGYDVWIANSRGTVYSRHH
TSLVSSDSAYWNWSWDELSSKDLSAEVQYVYSQAGQQKMHYVGHSLGTLI
ALAALSDQQQQIGMLRSAGLLSPIAFLDKMSSPLARAAADVFLAEALYWL
GLSEFDPTGEYVHSLVTDICKQPGIDCYNLMSAFTGDNCCLDNSSVQVFL
AHEPQATATKNMIHLAQMIRGGTIAKYDYGNAGDNREHYGQATPPAYDVT
AIPGDFPLFLSYGGRDSLSDVQDVSRPLRALGQSHSRDGDKLTVQYLADY
AHADFVMARNAGERVYAPLMAFFTLQEK


References
    Title: Less explored plant lipases: Modeling and molecular dynamics simulations of plant lipases in different solvents and temperatures to understand structure-function relationship
    Sankar S, Ponnuraj K
    Ref: Int J Biol Macromol, 164:3546, 2020 : PubMed

            

    Title: The Genomes of Oryza sativa: a history of duplications
    Yu J, Wang J, Lin W, Li S, Li H, Zhou J, Ni P, Dong W, Hu S and Yang H <88 more author(s)>
    Ref: PLoS Biol, 3:e38, 2005 : PubMed

            

    Title: Sequence and analysis of rice chromosome 4
    Feng Q, Zhang Y, Hao P, Wang S, Fu G, Huang Y, Li Y, Zhu J, Liu Y and Han B <61 more author(s)>
    Ref: Nature, 420:316, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer