(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Eukaryota: NE > Opisthokonta: NE > Fungi: NE > Dikarya: NE > Ascomycota: NE > saccharomyceta: NE > Saccharomycotina: NE > Saccharomycetes: NE > Saccharomycetales: NE > Saccharomycetaceae: NE > Saccharomyces: NE > Saccharomyces cerevisiae: NE
6_AlphaBeta_hydrolase : yeast-SCYNR064CSaccharomycescerevisiae SCYNR064C, yeast-ynl5Saccharomyces cerevisiae (Baker's yeast) YNL115C hypothetical 74.0 kda protein in mls1-rpc19 intergenic region, yeast-YOR084W Saccharomyces cerevisiae (Baker's yeast) Peroxisomal membrane protein LPX1 chromosome xv reading frame orf yor084w, yeast-ymc0Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). Uncharacterized protein YML020W. A85-EsteraseD-FGH : yeast-yjg8 Saccharomyces cerevisiae (Baker's yeast)) S-formylglutathione hydrolase. ABHD11-Acetyl_transferase : yeast-yg1lSaccharomyces cerevisiae (Baker's yeast) IMO32 hypothetical 38.5 kda protein in erv1-gls2 intergenic region, yeast-yg19Saccharomyces cerevisiae (Baker's yeast) EAT1 YGR015C hypothetical 37.9 kda protein in msb2-uga1 intergenic region. ABHD13-BEM46 : yeast-yn60Saccharomyces cerevisiae (Baker's yeast) hypothetical 32.3 kda protein in kre1-hxt14 intergenic region. abh_upf0017 : yeast-MCFS1Saccharomyces cerevisiae (Baker's yeast) Acyl-coenzymeA:ethanol O-acyltransferase 51.7 kda sec62-msy1 intergenic region ypl095c, yeast-ym60Saccharomyces cerevisiae (Baker's yeast) monoacylglycerol lipase YMR210W 51.4 kda protein YM8261.04 in rar1-scj1 intergenic region. Acidic_Lipase : yeast-tgl1Saccharomyces cerevisiae (Baker's yeast) triglyceride lipase-cholesterol esterase (EC 3.1.1.-) Tgl1p, yeast-YLL012WSaccharomyces cerevisiae (Baker's yeast) chromosome xii yll012w Yeh1p Steryl ester hydrolase, yeast-YLR020CSaccharomyces cerevisiae (Baker's yeast) chromosome xii ylr020c Yeh2p. AlphaBeta_hydrolase : yeast-LDH1Saccharomyces cerevisiae (Yeast) Lipid droplet hydrolase 1 chromosome II reading frame ORF YBR204c, yeast-YDL057WSaccharomyces cerevisiae (Baker's yeast) chromosome IV reading frame orf ydl057w. Arb2_domain : yeast-hda1 Saccharomyces cerevisiae (Baker's yeast); Saccharomyces cerevisiae x Saccharomyces kudriavzevii . Histone deacetylase HDA1 (only c-term Arb2 domain). Carboxypeptidase_S10 : yeast-cbpy1 Saccharomyces cerevisiae Carboxypeptidase Y, vacuolar PRC1 gene encoding preproprotein carboxypeptidase Y (CPY), yeast-kex01 Saccharomyces cerevisiae, yeast Pheromone-processing carboxypeptidase KEX1, yeast-yby9Saccharomyces cerevisiae chromosome II reading frame ORF YBR139w. CGI-58_ABHD5_ABHD4 : yeast-cld1Saccharomyces cerevisiae (Baker's yeast) YGR110W hypothetical 52.0 kda protein in clb6-shy1 intergenic region, yeast-ECM18Saccharomyces cerevisiae (Baker's yeast) (and strains YJM789; AWRI1631; Lalvin EC1118 / Prise de mousse; RM11-1a; JAY291) hypothetical 53.2 kda extracellular matrix protein 18, yeast-ict1Saccharomyces cerevisiae (Baker's yeast) chromosome XII reading frame orf ylr099c Increased copper tolerance protein 1. Dienelactone_hydrolase : yeast-AIM2Saccharomyces cerevisiae (Baker's yeast) yae9 hypothetical 27.1 kda protein in acs1-gcv3 intergenic region, yeast-dlhhSaccharomyces cerevisiae (Baker's yeast) hydrolase) (dlh). DPP4N_Peptidase_S9 : yeast-dap1Saccharomyces cerevisiae (Baker's yeast) dipeptidyl aminopeptidase (STE13 or YCI1), yeast-dap2Saccharomyces cerevisiae (Baker's yeast) yhr028c gene for dipeptidyl aminopeptidase B (DPAP B). Duf_676 : yeast-ROG1Saccharomyces cerevisiae (Baker's yeast) Putative lipase ROG1 ygo4 78.1 kda protein in tip20-mrf1 intergenic region ygl144c, yeast-YDL109CSaccharomyces cerevisiae (Baker's yeast) chromosome IV reading frame orf ydl109c, yeast-YDR444WSaccharomyces cerevisiae (Baker's yeast) d9461.29p, yeast-yo059Saccharomyces cerevisiae (Baker's yeast) Putative lipase YOR059C LPL1 chromosome xv orf yor059c YOR29-10. Duf_726 : yeast-yfd4Saccharomyces cerevisiae (Baker's yeast) (strains YJM789; RM11-1a; AWRI1631) Uncharacterized membrane protein Mil1 YFL034W. FSH1 : yeast-FSH1 Saccharomyces cerevisiae (Baker's yeast); Saccharomyces arboricola; Saccharomyces eubayanus family of serine hydrolases 1 (EC 3.1.-.-) in aap1-smf2 intergenic region, yeast-FSH2Saccharomyces cerevisiae (Baker's yeast) hypothetical 24.5 kda protein in erg8-ubp8 intergenic region, yeast-FSH3Saccharomyces cerevisiae (Baker's yeast) hypothetical dihydrofolate reductase. Homoserine_transacetylase : yeast-met2Saccharomyces cerevisiae (Baker's yeast), Saccharomyces sp., Saccharomyces paradoxus, S. uvarum, S. bayanus, S. pastorianus, S carlsbergensis, S. bayanus x S. cerevisiae, Homoserine O-trans-acetylase. Kynurenine-formamidase : yeast-YDR428C Saccharomyces cerevisiae (Baker's yeast); Saccharomyces sp. Kynurenine formamidase KFA d9461.15p. LIDHydrolase : yeast-YPR147CSaccharomyces cerevisiae (Baker's yeast) YPR147cp lipid droplet associated enzyme triacylglycerol lipase and ester hydrolase. Lipase_3 : yeast-ATG15CDS from: Saccharomyces cerevisiae (and strain YJM789) lipase involved in lipid vesicles degradation YCR068W Cytoplasm to vacuole targeting protein 17 ATG15, yeast-yj77Saccharomyces cerevisiae chromosome X reading frame ORF YJR107w. LYsophospholipase_carboxylesterase : yeast-YLR118cSaccharomyces cerevisiae Ylr118c protein and gene in chromosome XII cosmid 9233. Monoglyceridelipase_lysophospholip : yeast-mgll Saccharomyces cerevisiae (Baker's yeast) MGLL Yju3p YKL094W YKL441 Monoglyceride lipase. PC-sterol_acyltransferase : yeast-pdatSaccharomyces cerevisiae (Baker's yeast) phospholipid:diacylglycerol acyltransferase (EC 2.3.1.158) (pdat) LRO1, yeast-yj68Saccharomyces cerevisiae (Baker's yeast) (and strain AWRI1631) hypothetical 74.1 kda protein in acr1-yuh1 intergenic region. PGAP1 : yeast-BST1Saccharomyces cerevisiae (Baker's yeast), BST1, YFL025C, GPI inositol-deacylase, yeast-tgl2Saccharomyces cerevisiae (Baker's yeast) (and strains YJM789; JAY291; AWRI1631; Lalvin EC1118 / Prise de mousse; RM11-1a) lipase 2 (EC 3.1.1.3) (triacylglycerol lipase). PPase_methylesterase_euk : yeast-ppme1Saccharomyces cerevisiae (Baker's yeast) protein phosphatase methylesterase 1 (EC 3.1.1.-) (pme-1) (yms2). Steryl_acetyl_hydrolase : yeast-SAY1Saccharomyces cerevisiae (Baker's yeast) hypothetical 48.5da prot YG5J chromosome VII. T6SS-TLE1 : yeasv-e7ltm5Saccharomyces cerevisiae (strain VIN 13) (Baker's yeast). YEL023C-like protein
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Saccharomyces cerevisiae S288c: N, E.
Saccharomyces cerevisiae YJM789: N, E.
Saccharomyces cerevisiae RM11-1a: N, E.
Saccharomyces cerevisiae AWRI1631: N, E.
Saccharomyces cerevisiae JAY291: N, E.
Saccharomyces cerevisiae EC1118: N, E.
Saccharomyces cerevisiae AWRI796: N, E.
Saccharomyces cerevisiae Lalvin QA23: N, E.
Saccharomyces cerevisiae Vin13: N, E.
Saccharomyces cerevisiae FostersO: N, E.
Saccharomyces cerevisiae FostersB: N, E.
Saccharomyces cerevisiae VL3: N, E.
Saccharomyces cerevisiae Kyokai no. 7: N, E.
Saccharomyces cerevisiae P301: N, E.
Saccharomyces cerevisiae R103: N, E.
Saccharomyces cerevisiae CEN.PK113-7D: N, E.
Saccharomyces cerevisiae R008: N, E.
Saccharomyces cerevisiae P283: N, E.
Saccharomyces cerevisiae YJM993: N, E.
MSEVSKWPAINPFHWGYNGTVSHIVGENGSIKLHLKDNKEQVDFDEFANK
YVPTLKNGAQFKLSPYLFTGILQTLYLGAADFSKKFPVFYGREIVKFSDG
GVCTADWLIDSWKKDYEFDQSTTSFDKKKFDKDEKATHPEGWPRLQPRTR
YLKDNELEELREVDLPLVVILHGLAGGSHEPIIRSLAENLSRSGRFQVVV
LNTRGCARSKITTRNLFTAYHTMDIREFLQREKQRHPDRKLYAVGCSFGA
TMLANYLGEEGDKSPLSAAATLCNPWDLLLSAIRMSQDWWSRTLFSKNIA
QFLTRTVQVNMGELGVPNGSLPDHPPTVKNPSFYMFTPENLIKAKSFKST
REFDEVYTAPALGFPNAMEYYKAASSINRVDTIRVPTLVINSRDDPVVGP
DQPYSIVEKNPRILYCRTDLGGHLAYLDKDNNSWATKAIAEFFTKFDELV
V
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MSEVSKWPAINPFHWGYNGTVSHIVGENGSIKLHLKDNKEQVDFDEFANK YVPTLKNGAQFKLSPYLFTGILQTLYLGAADFSKKFPVFYGREIVKFSDG GVCTADWLIDSWKKDYEFDQSTTSFDKKKFDKDEKATHPEGWPRLQPRTR YLKDNELEELREVDLPLVVILHGLAGGSHEPIIRSLAENLSRSGRFQVVV LNTRGCARSKITTRNLFTAYHTMDIREFLQREKQRHPDRKLYAVGCSFGA TMLANYLGEEGDKSPLSAAATLCNPWDLLLSAIRMSQDWWSRTLFSKNIA QFLTRTVQVNMGELGVPNGSLPDHPPTVKNPSFYMFTPENLIKAKSFKST REFDEVYTAPALGFPNAMEYYKAASSINRVDTIRVPTLVINSRDDPVVGP DQPYSIVEKNPRILYCRTDLGGHLAYLDKDNNSWATKAIAEFFTKFDELV V
References
5 moreTitle: The yeast enzyme Eht1 is an octanoyl-CoA:ethanol acyltransferase that also functions as a thioesterase Knight MJ, Bull ID, Curnow P Ref: Yeast, 31:463, 2014 : PubMed
Fatty acid ethyl esters are secondary metabolites that are produced during microbial fermentation, in fruiting plants and in higher organisms during ethanol stress. In particular, volatile medium-chain fatty acid ethyl esters are important flavour compounds that impart desirable fruit aromas to fermented beverages, including beer and wine. The biochemical synthesis of medium-chain fatty acid ethyl esters is poorly understood but likely involves acyl-CoA:ethanol O-acyltransferases. Here, we characterize the enzyme ethanol hexanoyl transferase 1 (Eht1) from the brewer's yeast Saccharomyces cerevisiae. Full-length Eht1 was successfully overexpressed from a recombinant yeast plasmid and purified at the milligram scale after detergent solubilization of sedimenting membranes. Recombinant Eht1 was functional as an acyltransferase and, unexpectedly, was optimally active toward octanoyl-CoA, with kcat = 0.28 +/- 0.02/s and KM = 1.9 +/- 0.6 mum. Eht1 was also revealed to be active as a thioesterase but was not able to hydrolyse p-nitrophenyl acyl esters, in contrast to the findings of a previous study. Low-resolution structural data and site-directed mutagenesis provide experimental support for a predicted alpha/beta-hydrolase domain featuring a Ser-Asp-His catalytic triad. The S. cerevisiae gene YBR177C/EHT1 should thus be reannotated as coding for an octanoyl-CoA:ethanol acyltransferase that can also function as a thioesterase. (c) 2014 The Authors. Yeast published by John Wiley & Sons, Ltd.
Fatty acid ethyl esters are secondary metabolites produced by Saccharomyces cerevisiae and many other fungi. Their natural physiological role is not known but in fermentations of alcoholic beverages and other food products they play a key role as flavor compounds. Information about the metabolic pathways and enzymology of fatty acid ethyl ester biosynthesis, however, is very limited. In this work, we have investigated the role of a three-member S. cerevisiae gene family with moderately divergent sequences (YBR177c/EHT1, YPL095c/EEB1, and YMR210w). We demonstrate that two family members encode an acyl-coenzymeA:ethanol O-acyltransferase, an enzyme required for the synthesis of medium-chain fatty acid ethyl esters. Deletion of either one or both of these genes resulted in severely reduced medium-chain fatty acid ethyl ester production. Purified glutathione S-transferase-tagged Eht1 and Eeb1 proteins both exhibited acyl-coenzymeA:ethanol O-acyltransferase activity in vitro, as well as esterase activity. Overexpression of Eht1 and Eeb1 did not enhance medium-chain fatty acid ethyl ester content, which is probably due to the bifunctional synthesis and hydrolysis activity. Molecular modeling of Eht1 and Eeb1 revealed the presence of a alpha/beta-hydrolase fold, which is generally present in the substrate-binding site of esterase enzymes. Hence, our results identify Eht1 and Eeb1 as novel acyl-coenzymeA:ethanol O-acyltransferases/esterases, whereas the third family member, Ymr210w, does not seem to play an important role in medium-chain fatty acid ethyl ester formation.
The availability of complete genomic sequences and technologies that allow comprehensive analysis of global expression profiles of messenger RNA have greatly expanded our ability to monitor the internal state of a cell. Yet biological systems ultimately need to be explained in terms of the activity, regulation and modification of proteins--and the ubiquitous occurrence of post-transcriptional regulation makes mRNA an imperfect proxy for such information. To facilitate global protein analyses, we have created a Saccharomyces cerevisiae fusion library where each open reading frame is tagged with a high-affinity epitope and expressed from its natural chromosomal location. Through immunodetection of the common tag, we obtain a census of proteins expressed during log-phase growth and measurements of their absolute levels. We find that about 80% of the proteome is expressed during normal growth conditions, and, using additional sequence information, we systematically identify misannotated genes. The abundance of proteins ranges from fewer than 50 to more than 10(6) molecules per cell. Many of these molecules, including essential proteins and most transcription factors, are present at levels that are not readily detectable by other proteomic techniques nor predictable by mRNA levels or codon bias measurements.
        
5 lessTitle: The yeast enzyme Eht1 is an octanoyl-CoA:ethanol acyltransferase that also functions as a thioesterase Knight MJ, Bull ID, Curnow P Ref: Yeast, 31:463, 2014 : PubMed
Fatty acid ethyl esters are secondary metabolites that are produced during microbial fermentation, in fruiting plants and in higher organisms during ethanol stress. In particular, volatile medium-chain fatty acid ethyl esters are important flavour compounds that impart desirable fruit aromas to fermented beverages, including beer and wine. The biochemical synthesis of medium-chain fatty acid ethyl esters is poorly understood but likely involves acyl-CoA:ethanol O-acyltransferases. Here, we characterize the enzyme ethanol hexanoyl transferase 1 (Eht1) from the brewer's yeast Saccharomyces cerevisiae. Full-length Eht1 was successfully overexpressed from a recombinant yeast plasmid and purified at the milligram scale after detergent solubilization of sedimenting membranes. Recombinant Eht1 was functional as an acyltransferase and, unexpectedly, was optimally active toward octanoyl-CoA, with kcat = 0.28 +/- 0.02/s and KM = 1.9 +/- 0.6 mum. Eht1 was also revealed to be active as a thioesterase but was not able to hydrolyse p-nitrophenyl acyl esters, in contrast to the findings of a previous study. Low-resolution structural data and site-directed mutagenesis provide experimental support for a predicted alpha/beta-hydrolase domain featuring a Ser-Asp-His catalytic triad. The S. cerevisiae gene YBR177C/EHT1 should thus be reannotated as coding for an octanoyl-CoA:ethanol acyltransferase that can also function as a thioesterase. (c) 2014 The Authors. Yeast published by John Wiley & Sons, Ltd.
Bioethanol is a biofuel produced mainly from the fermentation of carbohydrates derived from agricultural feedstocks by the yeast Saccharomyces cerevisiae. One of the most widely adopted strains is PE-2, a heterothallic diploid naturally adapted to the sugar cane fermentation process used in Brazil. Here we report the molecular genetic analysis of a PE-2 derived diploid (JAY270), and the complete genome sequence of a haploid derivative (JAY291). The JAY270 genome is highly heterozygous (approximately 2 SNPs/kb) and has several structural polymorphisms between homologous chromosomes. These chromosomal rearrangements are confined to the peripheral regions of the chromosomes, with breakpoints within repetitive DNA sequences. Despite its complex karyotype, this diploid, when sporulated, had a high frequency of viable spores. Hybrid diploids formed by outcrossing with the laboratory strain S288c also displayed good spore viability. Thus, the rearrangements that exist near the ends of chromosomes do not impair meiosis, as they do not span regions that contain essential genes. This observation is consistent with a model in which the peripheral regions of chromosomes represent plastic domains of the genome that are free to recombine ectopically and experiment with alternative structures. We also explored features of the JAY270 and JAY291 genomes that help explain their high adaptation to industrial environments, exhibiting desirable phenotypes such as high ethanol and cell mass production and high temperature and oxidative stress tolerance. The genomic manipulation of such strains could enable the creation of a new generation of industrial organisms, ideally suited for use as delivery vehicles for future bioenergy technologies.
Saccharomyces cerevisiae has been used for millennia in winemaking, but little is known about the selective forces acting on the wine yeast genome. We sequenced the complete genome of the diploid commercial wine yeast EC1118, resulting in an assembly of 31 scaffolds covering 97% of the S288c reference genome. The wine yeast differed strikingly from the other S. cerevisiae isolates in possessing 3 unique large regions, 2 of which were subtelomeric, the other being inserted within an EC1118 chromosome. These regions encompass 34 genes involved in key wine fermentation functions. Phylogeny and synteny analyses showed that 1 of these regions originated from a species closely related to the Saccharomyces genus, whereas the 2 other regions were of non-Saccharomyces origin. We identified Zygosaccharomyces bailii, a major contaminant of wine fermentations, as the donor species for 1 of these 2 regions. Although natural hybridization between Saccharomyces strains has been described, this report provides evidence that gene transfer may occur between Saccharomyces and non-Saccharomyces species. We show that the regions identified are frequent and differentially distributed among S. cerevisiae clades, being found almost exclusively in wine strains, suggesting acquisition through recent transfer events. Overall, these data show that the wine yeast genome is subject to constant remodeling through the contribution of exogenous genes. Our results suggest that these processes are favored by ecologic proximity and are involved in the molecular adaptation of wine yeasts to conditions of high sugar, low nitrogen, and high ethanol concentrations.
Many industrial strains of Saccharomyces cerevisiae have been selected primarily for their ability to convert sugars into ethanol efficiently despite exposure to a variety of stresses. To begin investigation of the genetic basis of phenotypic variation in industrial strains of S. cerevisiae, we have sequenced the genome of a wine yeast, AWRI1631, and have compared this sequence with both the laboratory strain S288c and the human pathogenic isolate YJM789. AWRI1631 was found to be substantially different from S288c and YJM789, especially at the level of single-nucleotide polymorphisms, which were present, on average, every 150 bp between all three strains. In addition, there were major differences in the arrangement and number of Ty elements between the strains, as well as several regions of DNA that were specific to AWRI1631 and that were predicted to encode proteins that are unique to this industrial strain.
We sequenced the genome of Saccharomyces cerevisiae strain YJM789, which was derived from a yeast isolated from the lung of an AIDS patient with pneumonia. The strain is used for studies of fungal infections and quantitative genetics because of its extensive phenotypic differences to the laboratory reference strain, including growth at high temperature and deadly virulence in mouse models. Here we show that the approximately 12-Mb genome of YJM789 contains approximately 60,000 SNPs and approximately 6,000 indels with respect to the reference S288c genome, leading to protein polymorphisms with a few known cases of phenotypic changes. Several ORFs are found to be unique to YJM789, some of which might have been acquired through horizontal transfer. Localized regions of high polymorphism density are scattered over the genome, in some cases spanning multiple ORFs and in others concentrated within single genes. The sequence of YJM789 contains clues to pathogenicity and spurs the development of more powerful approaches to dissecting the genetic basis of complex hereditary traits.
Fatty acid ethyl esters are secondary metabolites produced by Saccharomyces cerevisiae and many other fungi. Their natural physiological role is not known but in fermentations of alcoholic beverages and other food products they play a key role as flavor compounds. Information about the metabolic pathways and enzymology of fatty acid ethyl ester biosynthesis, however, is very limited. In this work, we have investigated the role of a three-member S. cerevisiae gene family with moderately divergent sequences (YBR177c/EHT1, YPL095c/EEB1, and YMR210w). We demonstrate that two family members encode an acyl-coenzymeA:ethanol O-acyltransferase, an enzyme required for the synthesis of medium-chain fatty acid ethyl esters. Deletion of either one or both of these genes resulted in severely reduced medium-chain fatty acid ethyl ester production. Purified glutathione S-transferase-tagged Eht1 and Eeb1 proteins both exhibited acyl-coenzymeA:ethanol O-acyltransferase activity in vitro, as well as esterase activity. Overexpression of Eht1 and Eeb1 did not enhance medium-chain fatty acid ethyl ester content, which is probably due to the bifunctional synthesis and hydrolysis activity. Molecular modeling of Eht1 and Eeb1 revealed the presence of a alpha/beta-hydrolase fold, which is generally present in the substrate-binding site of esterase enzymes. Hence, our results identify Eht1 and Eeb1 as novel acyl-coenzymeA:ethanol O-acyltransferases/esterases, whereas the third family member, Ymr210w, does not seem to play an important role in medium-chain fatty acid ethyl ester formation.
The availability of complete genomic sequences and technologies that allow comprehensive analysis of global expression profiles of messenger RNA have greatly expanded our ability to monitor the internal state of a cell. Yet biological systems ultimately need to be explained in terms of the activity, regulation and modification of proteins--and the ubiquitous occurrence of post-transcriptional regulation makes mRNA an imperfect proxy for such information. To facilitate global protein analyses, we have created a Saccharomyces cerevisiae fusion library where each open reading frame is tagged with a high-affinity epitope and expressed from its natural chromosomal location. Through immunodetection of the common tag, we obtain a census of proteins expressed during log-phase growth and measurements of their absolute levels. We find that about 80% of the proteome is expressed during normal growth conditions, and, using additional sequence information, we systematically identify misannotated genes. The abundance of proteins ranges from fewer than 50 to more than 10(6) molecules per cell. Many of these molecules, including essential proteins and most transcription factors, are present at levels that are not readily detectable by other proteomic techniques nor predictable by mRNA levels or codon bias measurements.
In the framework of the EU genome-sequencing programmes, the complete DNA sequence of the yeast Saccharomyces cerevisiae chromosome II (807 188 bp) has been determined. At present, this is the largest eukaryotic chromosome entirely sequenced. A total of 410 open reading frames (ORFs) were identified, covering 72% of the sequence. Similarity searches revealed that 124 ORFs (30%) correspond to genes of known function, 51 ORFs (12.5%) appear to be homologues of genes whose functions are known, 52 others (12.5%) have homologues the functions of which are not well defined and another 33 of the novel putative genes (8%) exhibit a degree of similarity which is insufficient to confidently assign function. Of the genes on chromosome II, 37-45% are thus of unpredicted function. Among the novel putative genes, we found several that are related to genes that perform differentiated functions in multicellular organisms of are involved in malignancy. In addition to a compact arrangement of potential protein coding sequences, the analysis of this chromosome confirmed general chromosome patterns but also revealed particular novel features of chromosomal organization. Alternating regional variations in average base composition correlate with variations in local gene density along chromosome II, as observed in chromosomes XI and III. We propose that functional ARS elements are preferably located in the AT-rich regions that have a spacing of approximately 110 kb. Similarly, the 13 tRNA genes and the three Ty elements of chromosome II are found in AT-rich regions. In chromosome II, the distribution of coding sequences between the two strands is biased, with a ratio of 1.3:1. An interesting aspect regarding the evolution of the eukaryotic genome is the finding that chromosome II has a high degree of internal genetic redundancy, amounting to 16% of the coding capacity.