Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-MCFS2

Saccharomyces cerevisiae (Baker's yeast) EHT1, MCFS2, YBR177C, YBR1239 alcohol acyl transferase (octanoyl-CoA:ethanol acyltransferase also thioesterase)

Comment
Other strains: Saccharomyces cerevisiae (strain ATCC 204508 / S288c; RM11-1a; AWRI796; JAY291; AWRI1631; YJM789; VIN 13; FostersB) (Baker's yeast)


Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : Z36046
>3 UniProt links 5 more: P38295, B3LMY3, E9P8C9
>3 UniProt links 5 more: P38295, B3LMY3, E9P8C9
>3 Interpro links 5 more: P38295, B3LMY3, E9P8C9
>3 Prodom links 5 more: P38295, B3LMY3, E9P8C9
>3 Pfam links 5 more: P38295, B3LMY3, E9P8C9
>3 PIRSF links 5 more: P38295, B3LMY3, E9P8C9
>3 SUPERFAM links 5 more: P38295, B3LMY3, E9P8C9
1 SGD : S0000381
Sequence
Graphical view for this peptide sequence: yeast-MCFS2
Colored MSA for abh_upf0017 (raw)
MSEVSKWPAINPFHWGYNGTVSHIVGENGSIKLHLKDNKEQVDFDEFANK
YVPTLKNGAQFKLSPYLFTGILQTLYLGAADFSKKFPVFYGREIVKFSDG
GVCTADWLIDSWKKDYEFDQSTTSFDKKKFDKDEKATHPEGWPRLQPRTR
YLKDNELEELREVDLPLVVILHGLAGGSHEPIIRSLAENLSRSGRFQVVV
LNTRGCARSKITTRNLFTAYHTMDIREFLQREKQRHPDRKLYAVGCSFGA
TMLANYLGEEGDKSPLSAAATLCNPWDLLLSAIRMSQDWWSRTLFSKNIA
QFLTRTVQVNMGELGVPNGSLPDHPPTVKNPSFYMFTPENLIKAKSFKST
REFDEVYTAPALGFPNAMEYYKAASSINRVDTIRVPTLVINSRDDPVVGP
DQPYSIVEKNPRILYCRTDLGGHLAYLDKDNNSWATKAIAEFFTKFDELV
V
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSEVSKWPAINPFHWGYNGTVSHIVGENGSIKLHLKDNKEQVDFDEFANK
YVPTLKNGAQFKLSPYLFTGILQTLYLGAADFSKKFPVFYGREIVKFSDG
GVCTADWLIDSWKKDYEFDQSTTSFDKKKFDKDEKATHPEGWPRLQPRTR
YLKDNELEELREVDLPLVVILHGLAGGSHEPIIRSLAENLSRSGRFQVVV
LNTRGCARSKITTRNLFTAYHTMDIREFLQREKQRHPDRKLYAVGCSFGA
TMLANYLGEEGDKSPLSAAATLCNPWDLLLSAIRMSQDWWSRTLFSKNIA
QFLTRTVQVNMGELGVPNGSLPDHPPTVKNPSFYMFTPENLIKAKSFKST
REFDEVYTAPALGFPNAMEYYKAASSINRVDTIRVPTLVINSRDDPVVGP
DQPYSIVEKNPRILYCRTDLGGHLAYLDKDNNSWATKAIAEFFTKFDELV
V


References
5 more
    Title: The yeast enzyme Eht1 is an octanoyl-CoA:ethanol acyltransferase that also functions as a thioesterase
    Knight MJ, Bull ID, Curnow P
    Ref: Yeast, 31:463, 2014 : PubMed

            

    Title: The Saccharomyces cerevisiae EHT1 and EEB1 genes encode novel enzymes with medium-chain fatty acid ethyl ester synthesis and hydrolysis capacity
    Saerens SM, Verstrepen KJ, Van Laere SD, Voet AR, Van Dijck P, Delvaux FR, Thevelein JM
    Ref: Journal of Biological Chemistry, 281:4446, 2006 : PubMed

            

    Title: Global analysis of protein expression in yeast
    Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS
    Ref: Nature, 425:737, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer