human-CEL

Homo sapiens (Human) bile-salt-activated lipase, BSSL BAL CEL CEH carboxyl ester lipase chr 9

Comment

"The human lactating mammary gland and pancreas produce a lipolytic enzyme, carboxyl-ester lipase, earlier called bile salt-stimulated lipase. Carboxyl-ester lipase is a major component of pancreatic juice and is responsible for the hydrolysis of cholesterol esters as well as a variety of other dietary esters. The enzyme exerts its function in duodenal juice, is activated when mixed with bile salts, and plays an important role in the digestion of milk fat in newborn infants. By genomewide screen in one of their families with diabetes and exocrine pancreatic dysfunction, Raeder et al. (2006) linked diabetes to 9q34 (maximum lod score 5.07). In each of the 2 families with autosomal dominantly inherited diabetes and exocrine pancreas dysfunction described by them, Raeder et al. (2006) demonstrated a different single-base deletion causing frameshift in the variable number of tandem repeats (VNTR normal range 7-23 repeats in healthy controls) of the gene encoding carboxyl-ester lipase (CEL\; 114840).tandem repeat domain may contribute to different short and long range interactions with the globular core domain and other macromolecules, including cell membranes. CEL-MODY is a protein misfolding disease caused by a negative gain-of-function effect of the mutant proteins in pancreatic tissues. (AF081673 O75612 onco fetal isoform feto-acinar pancreatic protein.slightly different c-terminus. Human protein for lipoamidase PIR S32318 Trembl Q9UCH1) (On chromosome 9 9q34 in the NT_000529 contig, the gene is followed by a carboxyl ester lipase pseudogene which includes exons 1, 8, 9, 10, and 11 of the wildtype gene peptide ENST00000252493 gene ENSG00000130210). Numerous repeats at the c-term excluded in ESTHER (only n-term Pfam A COesterase 1 544) bile salt-dependent lipase (BSDL)"

Relationship

Family : Cholesterol_esterase

Block : C

Position in NCBI Life Tree : Homo sapiens

Sequence

Peptide

MLTMGRLQLVVLGLTCCWAVASAAKLGAVYTEGGFVEGVN
KKLGLLGDSV DIFKGIPFAAPTKALENPQPHPGWQGTLK
AKNFKKRCLQATITQDSTYGD EDCLYLNIWVPQGRKQVS
RDLPVMIWIYGGAFLMGSGHGANFLNNYLYDG EEIATRG
NVIVVTFNYRVGPLGFLSTGDANLPGNYGLRDQHMAIAWV
KRN IAAFGGDPNNITLFGESAGGASVSLQTLSPYNKGLI
RRAISQSGVALSPW VIQKNPLFWAKKVAEKVGCPVGDAA
RMAQCLKVTDPRALTLAYKVPLAGL EYPMLHYVGFVPVI
DGDFIPADPINLYANAADIDYIAGTNNMDGHIFASI DMP
AINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDVYTES
WAQDPSQ ENKKKTVVDFETDVLFLVPTEIALAQHRANAK
SAKTYAYLFSHPSRMPVY PKWVGADHADDIQYVFGKPFA
TPTGYRPQDRTVSKAMIAYWTNFAKTGDP NMGDSAVPTH
WEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYL
ALPTVTD

References

Title : Identification and characterization of novel carboxyl ester lipase gene variants in patients with different subtypes of diabetes - Wu_2023_BMJ.Open.Diabetes.Res.Care_11_e003127
Author(s) : Wu H , Shu M , Liu C , Zhao W , Li Q , Song Y , Zhang T , Chen X , Shi Y , Shi P , Fang L , Wang R , Xu C
Ref : BMJ Open Diabetes Res Care , 11 : , 2023
Abstract : Wu_2023_BMJ.Open.Diabetes.Res.Care_11_e003127
ESTHER : Wu_2023_BMJ.Open.Diabetes.Res.Care_11_e003127
PubMedSearch : Wu_2023_BMJ.Open.Diabetes.Res.Care_11_e003127
PubMedID: 36634979
Gene_locus related to this paper: human-CEL

Title : Identification of a Novel Mutation in Carboxyl Ester Lipase Gene in a Patient with MODY-like Diabetes - Kondoh_2022_Tohoku.J.Exp.Med_256_37
Author(s) : Kondoh T , Nakajima Y , Yokoi K , Matsumoto Y , Inagaki H , Kato T , Ito T , Yoshikawa T , Kurahashi H
Ref : Tohoku J Exp Med , 256 :37 , 2022
Abstract : Kondoh_2022_Tohoku.J.Exp.Med_256_37
ESTHER : Kondoh_2022_Tohoku.J.Exp.Med_256_37
PubMedSearch : Kondoh_2022_Tohoku.J.Exp.Med_256_37
PubMedID: 35082198
Gene_locus related to this paper: human-CEL

Title : Abnormal exocrine-endocrine cell cross-talk promotes beta-cell dysfunction and loss in MODY8 - Kahraman_2022_Nat.Metab_4_76
Author(s) : Kahraman S , Dirice E , Basile G , Diegisser D , Alam J , Johansson BB , Gupta MK , Hu J , Huang L , Soh CL , Huangfu D , Muthuswamy SK , Raeder H , Molven A , Kulkarni RN
Ref : Nat Metab , 4 :76 , 2022
Abstract : Kahraman_2022_Nat.Metab_4_76
ESTHER : Kahraman_2022_Nat.Metab_4_76
PubMedSearch : Kahraman_2022_Nat.Metab_4_76
PubMedID: 35058633
Gene_locus related to this paper: human-CEL

Title : Two new mutations in the CEL gene causing diabetes and hereditary pancreatitis: How to correctly identify MODY8 cases - El Jellas_2021_J.Clin.Endocrinol.Metab__
Author(s) : El Jellas K , Dusatkova P , Haldorsen IS , Molnes J , Tjora E , Johansson BB , Fjeld K , Johansson S , Pruhova S , Groop L , Lohr JM , Njolstad PR , Molven A
Ref : J Clinical Endocrinology Metab , : , 2021
Abstract : El Jellas_2021_J.Clin.Endocrinol.Metab__
ESTHER : El Jellas_2021_J.Clin.Endocrinol.Metab__
PubMedSearch : El Jellas_2021_J.Clin.Endocrinol.Metab__
PubMedID: 34850019
Gene_locus related to this paper: human-CEL

Title : Single nucleotide polymorphisms in CEL-HYB1 increase risk for chronic pancreatitis through proteotoxic misfolding - Cassidy_2020_Hum.Mutat_41_1967
Author(s) : Cassidy BM , Zino S , Fjeld K , Molven A , Lowe ME , Xiao X
Ref : Hum Mutat , 41 :1967 , 2020
Abstract : Cassidy_2020_Hum.Mutat_41_1967
ESTHER : Cassidy_2020_Hum.Mutat_41_1967
PubMedSearch : Cassidy_2020_Hum.Mutat_41_1967
PubMedID: 32906201
Gene_locus related to this paper: human-CEL

Title : Pathogenic Carboxyl Ester Lipase (CEL) Variants Interact with the Normal CEL Protein in Pancreatic Cells - Dalva_2020_Cells_9_244
Author(s) : Dalva M , Lavik IK , El Jellas K , Gravdal A , Lugea A , Pandol SJ , Njolstad PR , Waldron RT , Fjeld K , Johansson BB , Molven A
Ref : Cells , 9 :244 , 2020
Abstract : Dalva_2020_Cells_9_244
ESTHER : Dalva_2020_Cells_9_244
PubMedSearch : Dalva_2020_Cells_9_244
PubMedID: 31963687
Gene_locus related to this paper: human-CEL

Title : X-ray structures of human bile-salt activated lipase conjugated to nerve agents surrogates - Touvrey_2019_Toxicology_411_15
Author(s) : Touvrey C , Courageux C , Guillon V , Terreux R , Nachon F , Brazzolotto X
Ref : Toxicology , 411 :15 , 2019
Abstract : Touvrey_2019_Toxicology_411_15
ESTHER : Touvrey_2019_Toxicology_411_15
PubMedSearch : Touvrey_2019_Toxicology_411_15
PubMedID: 30359675
Gene_locus related to this paper: human-CEL

Title : The role of the carboxyl ester lipase (CEL) gene in pancreatic disease - Johansson_2018_Pancreatology_18_12
Author(s) : Johansson BB , Fjeld K , El Jellas K , Gravdal A , Dalva M , Tjora E , Raeder H , Kulkarni RN , Johansson S , Njolstad PR , Molven A
Ref : Pancreatology , 18 :12 , 2018
Abstract : Johansson_2018_Pancreatology_18_12
ESTHER : Johansson_2018_Pancreatology_18_12
PubMedSearch : Johansson_2018_Pancreatology_18_12
PubMedID: 29233499
Gene_locus related to this paper: human-CEL

Title : Copy number variants and VNTR length polymorphisms of the carboxyl-ester lipase (CEL) gene as risk factors in pancreatic cancer - Dalva_2017_Pancreatology_17_83
Author(s) : Dalva M , El Jellas K , Steine SJ , Johansson BB , Ringdal M , Torsvik J , Immervoll H , Hoem D , Laemmerhirt F , Simon P , Lerch MM , Johansson S , Njolstad PR , Weiss FU , Fjeld K , Molven A
Ref : Pancreatology , 17 :83 , 2017
Abstract : Dalva_2017_Pancreatology_17_83
ESTHER : Dalva_2017_Pancreatology_17_83
PubMedSearch : Dalva_2017_Pancreatology_17_83
PubMedID: 27773618
Gene_locus related to this paper: human-CEL

Title : Branched Fatty Acid Esters of Hydroxy Fatty Acids Are Preferred Substrates of the MODY8 Protein Carboxyl Ester Lipase - Kolar_2016_Biochemistry_55_4636
Author(s) : Kolar MJ , Kamat SS , Parsons WH , Homan EA , Maher T , Peroni OD , Syed I , Fjeld K , Molven A , Kahn BB , Cravatt BF , Saghatelian A
Ref : Biochemistry , 55 :4636 , 2016
Abstract : Kolar_2016_Biochemistry_55_4636
ESTHER : Kolar_2016_Biochemistry_55_4636
PubMedSearch : Kolar_2016_Biochemistry_55_4636
PubMedID: 27509211
Gene_locus related to this paper: human-CEL

Title : A Carboxyl Ester Lipase (CEL) Mutant Causes Chronic Pancreatitis by Forming Intracellular Aggregates That Activate Apoptosis - Xiao_2016_J.Biol.Chem_291_23224
Author(s) : Xiao X , Jones G , Sevilla WA , Stolz DB , Magee KE , Haughney M , Mukherjee A , Wang Y , Lowe ME
Ref : Journal of Biological Chemistry , 291 :23224 , 2016
Abstract : Xiao_2016_J.Biol.Chem_291_23224
ESTHER : Xiao_2016_J.Biol.Chem_291_23224
PubMedSearch : Xiao_2016_J.Biol.Chem_291_23224
PubMedID: 27650499
Gene_locus related to this paper: human-CEL

Title : The number of tandem repeats in the carboxyl-ester lipase (CEL) gene as a risk factor in alcoholic and idiopathic chronic pancreatitis - Ragvin_2013_Pancreatology_13_29
Author(s) : Ragvin A , Fjeld K , Weiss FU , Torsvik J , Aghdassi A , Mayerle J , Simon P , Njolstad PR , Lerch MM , Johansson S , Molven A
Ref : Pancreatology , 13 :29 , 2013
Abstract : Ragvin_2013_Pancreatology_13_29
ESTHER : Ragvin_2013_Pancreatology_13_29
PubMedSearch : Ragvin_2013_Pancreatology_13_29
PubMedID: 23395566
Gene_locus related to this paper: human-CEL

Title : The galactolipase activity of some microbial lipases and pancreatic enzymes - Amara_2013_Eur.J.Lipid.Sci.Technol_115_442
Author(s) : Amara S , Lafont D , Parsiegla G , Point V , Chabannes A , Rousset A , Carriere F
Ref : Eur J Lipid Sci Technol , 115 :442 , 2013
Abstract : Amara_2013_Eur.J.Lipid.Sci.Technol_115_442
ESTHER : Amara_2013_Eur.J.Lipid.Sci.Technol_115_442
PubMedSearch : Amara_2013_Eur.J.Lipid.Sci.Technol_115_442
PubMedID:
Gene_locus related to this paper: bovin-balip , human-CEL

Title : Analysis of the discriminative inhibition of mammalian digestive lipases by 3-phenyl substituted 1,3,4-oxadiazol-2(3H)-ones. - Point_2012_Eur.J.Med.Chem_58_452
Author(s) : Point V , Pavan Kumar KV , Marc S , Delorme V , Parsiegla G , Amara S , Carriere F , Buono G , Fotiadu F , Canaan S , Leclaire J , Cavalier JF
Ref : Eur Journal of Medicinal Chemistry , 58 :452 , 2012
Abstract : Point_2012_Eur.J.Med.Chem_58_452
ESTHER : Point_2012_Eur.J.Med.Chem_58_452
PubMedSearch : Point_2012_Eur.J.Med.Chem_58_452
PubMedID: 23153815
Gene_locus related to this paper: canfa-1lipg , cavpo-2plrp , human-CEL , human-PNLIP , human-PNLIPRP2 , pig-1plip

Title : Diabetes and pancreatic exocrine dysfunction due to mutations in the carboxyl ester lipase gene-maturity onset diabetes of the young (CEL-MODY): a protein misfolding disease - Johansson_2011_J.Biol.Chem_286_34593
Author(s) : Johansson BB , Torsvik J , Bjorkhaug L , Vesterhus M , Ragvin A , Tjora E , Fjeld K , Hoem D , Johansson S , Raeder H , Lindquist S , Hernell O , Cnop M , Saraste J , Flatmark T , Molven A , Njolstad PR
Ref : Journal of Biological Chemistry , 286 :34593 , 2011
Abstract : Johansson_2011_J.Biol.Chem_286_34593
ESTHER : Johansson_2011_J.Biol.Chem_286_34593
PubMedSearch : Johansson_2011_J.Biol.Chem_286_34593
PubMedID: 21784842
Gene_locus related to this paper: human-CEL

Title : Mutations in the VNTR of the carboxyl-ester lipase gene (CEL) are a rare cause of monogenic diabetes - Torsvik_2010_Hum.Genet_127_55
Author(s) : Torsvik J , Johansson S , Johansen A , Ek J , Minton J , Raeder H , Ellard S , Hattersley A , Pedersen O , Hansen T , Molven A , Njolstad PR
Ref : Hum Genet , 127 :55 , 2010
Abstract : Torsvik_2010_Hum.Genet_127_55
ESTHER : Torsvik_2010_Hum.Genet_127_55
PubMedSearch : Torsvik_2010_Hum.Genet_127_55
PubMedID: 19760265
Gene_locus related to this paper: human-CEL

Title : Pancreatic function in carboxyl-ester lipase knockout mice - Vesterhus_2010_Pancreatology_10_467
Author(s) : Vesterhus M , Raeder H , Kurpad AJ , Kawamori D , Molven A , Kulkarni RN , Kahn CR , Njolstad PR
Ref : Pancreatology , 10 :467 , 2010
Abstract : Vesterhus_2010_Pancreatology_10_467
ESTHER : Vesterhus_2010_Pancreatology_10_467
PubMedSearch : Vesterhus_2010_Pancreatology_10_467
PubMedID: 20720448
Gene_locus related to this paper: human-CEL

Title : Pancreatic exocrine dysfunction in maturity-onset diabetes of the young type 3 - Vesterhus_2008_Diabetes.Care_31_306
Author(s) : Vesterhus M , Raeder H , Johansson S , Molven A , Njolstad PR
Ref : Diabetes Care , 31 :306 , 2008
Abstract : Vesterhus_2008_Diabetes.Care_31_306
ESTHER : Vesterhus_2008_Diabetes.Care_31_306
PubMedSearch : Vesterhus_2008_Diabetes.Care_31_306
PubMedID: 17989309
Gene_locus related to this paper: human-CEL

Title : Neurological features and enzyme therapy in patients with endocrine and exocrine pancreas dysfunction due to CEL mutations - Vesterhus_2008_Diabetes.Care_31_1738
Author(s) : Vesterhus M , Raeder H , Aurlien H , Gjesdal CG , Bredrup C , Holm PI , Molven A , Bindoff L , Berstad A , Njolstad PR
Ref : Diabetes Care , 31 :1738 , 2008
Abstract : Vesterhus_2008_Diabetes.Care_31_1738
ESTHER : Vesterhus_2008_Diabetes.Care_31_1738
PubMedSearch : Vesterhus_2008_Diabetes.Care_31_1738
PubMedID: 18544793
Gene_locus related to this paper: human-CEL

Title : Mutations in the CEL VNTR cause a syndrome of diabetes and pancreatic exocrine dysfunction. - Raeder_2006_Nat.Genet_38_54
Author(s) : Raeder H , Johansson S , Holm PI , Haldorsen IS , Mas E , Sbarra V , Nermoen I , Eide SA , Grevle L , Bjorkhaug L , Sagen JV , Aksnes L , Svik O , Lombardo D , Molven A , Njolstad PR
Ref : Nat Genet , 38 :54 , 2006
Abstract : Raeder_2006_Nat.Genet_38_54
ESTHER : Raeder_2006_Nat.Genet_38_54
PubMedSearch : Raeder_2006_Nat.Genet_38_54
PubMedID: 16369531
Gene_locus related to this paper: human-CEL

Title : In vitro polyphenol effects on activity, expression and secretion of pancreatic bile salt-dependent lipase - Sbarra_2005_Biochim.Biophys.Acta_1736_67
Author(s) : Sbarra V , Ristorcelli E , Petit-Thevenin JL , Teissedre PL , Lombardo D , Verine A
Ref : Biochimica & Biophysica Acta , 1736 :67 , 2005
Abstract : Sbarra_2005_Biochim.Biophys.Acta_1736_67
ESTHER : Sbarra_2005_Biochim.Biophys.Acta_1736_67
PubMedSearch : Sbarra_2005_Biochim.Biophys.Acta_1736_67
PubMedID: 16099206
Gene_locus related to this paper: human-CEL

Title : In vitro angiogenic effects of pancreatic bile salt-dependent lipase - Rebai_2005_Arterioscler.Thromb.Vasc.Biol_25_359
Author(s) : Rebai O , Le Petit-Thevenin J , Bruneau N , Lombardo D , Verine A
Ref : Arterioscler Thromb Vasc Biol , 25 :359 , 2005
Abstract : Rebai_2005_Arterioscler.Thromb.Vasc.Biol_25_359
ESTHER : Rebai_2005_Arterioscler.Thromb.Vasc.Biol_25_359
PubMedSearch : Rebai_2005_Arterioscler.Thromb.Vasc.Biol_25_359
PubMedID: 15569825
Gene_locus related to this paper: human-CEL

Title : DNA sequence and analysis of human chromosome 9 - Humphray_2004_Nature_429_369
Author(s) : Humphray SJ , Oliver K , Hunt AR , Plumb RW , Loveland JE , Howe KL , Andrews TD , Searle S , Hunt SE , Scott CE , Jones MC , Ainscough R , Almeida JP , Ambrose KD , Ashwell RI , Babbage AK , Babbage S , Bagguley CL , Bailey J , Banerjee R , Barker DJ , Barlow KF , Bates K , Beasley H , Beasley O , Bird CP , Bray-Allen S , Brown AJ , Brown JY , Burford D , Burrill W , Burton J , Carder C , Carter NP , Chapman JC , Chen Y , Clarke G , Clark SY , Clee CM , Clegg S , Collier RE , Corby N , Crosier M , Cummings AT , Davies J , Dhami P , Dunn M , Dutta I , Dyer LW , Earthrowl ME , Faulkner L , Fleming CJ , Frankish A , Frankland JA , French L , Fricker DG , Garner P , Garnett J , Ghori J , Gilbert JG , Glison C , Grafham DV , Gribble S , Griffiths C , Griffiths-Jones S , Grocock R , Guy J , Hall RE , Hammond S , Harley JL , Harrison ES , Hart EA , Heath PD , Henderson CD , Hopkins BL , Howard PJ , Howden PJ , Huckle E , Johnson C , Johnson D , Joy AA , Kay M , Keenan S , Kershaw JK , Kimberley AM , King A , Knights A , Laird GK , Langford C , Lawlor S , Leongamornlert DA , Leversha M , Lloyd C , Lloyd DM , Lovell J , Martin S , Mashreghi-Mohammadi M , Matthews L , Mclaren S , McLay KE , McMurray A , Milne S , Nickerson T , Nisbett J , Nordsiek G , Pearce AV , Peck AI , Porter KM , Pandian R , Pelan S , Phillimore B , Povey S , Ramsey Y , Rand V , Scharfe M , Sehra HK , Shownkeen R , Sims SK , Skuce CD , Smith M , Steward CA , Swarbreck D , Sycamore N , Tester J , Thorpe A , Tracey A , Tromans A , Thomas DW , Wall M , Wallis JM , West AP , Whitehead SL , Willey DL , Williams SA , Wilming L , Wray PW , Young L , Ashurst JL , Coulson A , Blocker H , Durbin R , Sulston JE , Hubbard T , Jackson MJ , Bentley DR , Beck S , Rogers J , Dunham I
Ref : Nature , 429 :369 , 2004
Abstract : Humphray_2004_Nature_429_369
ESTHER : Humphray_2004_Nature_429_369
PubMedSearch : Humphray_2004_Nature_429_369
PubMedID: 15164053
Gene_locus related to this paper: human-CEL

Title : Lectin-like Ox-LDL receptor is expressed in human INT-407 intestinal cells: involvement in the transcytosis of pancreatic bile salt-dependent lipase - Bruneau_2003_Mol.Biol.Cell_14_2861
Author(s) : Bruneau N , Richard S , Silvy F , Verine A , Lombardo D
Ref : Mol Biology of the cell , 14 :2861 , 2003
Abstract : Bruneau_2003_Mol.Biol.Cell_14_2861
ESTHER : Bruneau_2003_Mol.Biol.Cell_14_2861
PubMedSearch : Bruneau_2003_Mol.Biol.Cell_14_2861
PubMedID: 12857870
Gene_locus related to this paper: human-CEL

Title : Human bile salt-stimulated lipase has a high frequency of size variation due to a hypervariable region in exon 11 - Lindquist_2002_Eur.J.Biochem_269_759
Author(s) : Lindquist S , Blackberg L , Hernell O
Ref : European Journal of Biochemistry , 269 :759 , 2002
Abstract : Lindquist_2002_Eur.J.Biochem_269_759
ESTHER : Lindquist_2002_Eur.J.Biochem_269_759
PubMedSearch : Lindquist_2002_Eur.J.Biochem_269_759
PubMedID: 11846777
Gene_locus related to this paper: human-CEL

Title : Transcytosis of pancreatic bile salt-dependent lipase through human Int407 intestinal cells - Bruneau_2001_Exp.Cell.Res_271_94
Author(s) : Bruneau N , Nganga A , Bendayan M , Lombardo D
Ref : Experimental Cell Research , 271 :94 , 2001
Abstract : Bruneau_2001_Exp.Cell.Res_271_94
ESTHER : Bruneau_2001_Exp.Cell.Res_271_94
PubMedSearch : Bruneau_2001_Exp.Cell.Res_271_94
PubMedID: 11697886
Gene_locus related to this paper: human-CEL

Title : The structure of truncated recombinant human bile salt-stimulated lipase reveals bile salt-independent conformational flexibility at the active-site loop and provides insights into heparin binding - Moore_2001_J.Mol.Biol_312_511
Author(s) : Moore SA , Kingston RL , Loomes KM , Hernell O , Blackberg L , Baker HM , Baker EN
Ref : Journal of Molecular Biology , 312 :511 , 2001
Abstract : Moore_2001_J.Mol.Biol_312_511
ESTHER : Moore_2001_J.Mol.Biol_312_511
PubMedSearch : Moore_2001_J.Mol.Biol_312_511
PubMedID: 11563913
Gene_locus related to this paper: human-CEL

Title : The affinity binding sites of pancreatic bile salt-dependent lipase in pancreatic and intestinal tissues - Bruneau_2000_J.Histochem.Cytochem_48_267
Author(s) : Bruneau N , Lombardo D , Bendayan M
Ref : Journal of Histochemistry & Cytochemistry , 48 :267 , 2000
Abstract : Bruneau_2000_J.Histochem.Cytochem_48_267
ESTHER : Bruneau_2000_J.Histochem.Cytochem_48_267
PubMedSearch : Bruneau_2000_J.Histochem.Cytochem_48_267
PubMedID: 10639493
Gene_locus related to this paper: human-CEL

Title : Crystal structure of the catalytic domain of human bile salt activated lipase - Terzyan_2000_Protein.Sci_9_1783
Author(s) : Terzyan S , Wang CS , Downs D , Hunter B , Zhang XC
Ref : Protein Science , 9 :1783 , 2000
Abstract : Terzyan_2000_Protein.Sci_9_1783
ESTHER : Terzyan_2000_Protein.Sci_9_1783
PubMedSearch : Terzyan_2000_Protein.Sci_9_1783
PubMedID: 11045623
Gene_locus related to this paper: human-CEL

Title : Structural characterization of the N-linked oligosaccharides in bile salt-stimulated lipase originated from human breast milk - Mechref_1999_Glycobiology_9_227
Author(s) : Mechref Y , Chen P , Novotny MV
Ref : Glycobiology , 9 :227 , 1999
Abstract : Mechref_1999_Glycobiology_9_227
ESTHER : Mechref_1999_Glycobiology_9_227
PubMedSearch : Mechref_1999_Glycobiology_9_227
PubMedID: 10024660
Gene_locus related to this paper: human-CEL

Title : Lipid-lowering effects of WAY-121,898, an inhibitor of pancreatic cholesteryl ester hydrolase - Krause_1998_Lipids_33_489
Author(s) : Krause BR , Sliskovic DR , Anderson M , Homan R
Ref : Lipids , 33 :489 , 1998
Abstract : Krause_1998_Lipids_33_489
ESTHER : Krause_1998_Lipids_33_489
PubMedSearch : Krause_1998_Lipids_33_489
PubMedID: 9625596
Gene_locus related to this paper: human-CEL , ratno-balip , mesau-a0a1u8cxs4

Title : Participation of GRP94-related protein in secretion of pancreatic bile salt-dependent lipase and in its internalization by the intestinal epithelium - Bruneau_1998_J.Cell.Sci_111_2665
Author(s) : Bruneau N , Lombardo D , Bendayan M
Ref : Journal of Cell Science , 111 :2665 , 1998
Abstract : Bruneau_1998_J.Cell.Sci_111_2665
ESTHER : Bruneau_1998_J.Cell.Sci_111_2665
PubMedSearch : Bruneau_1998_J.Cell.Sci_111_2665
PubMedID: 9701565
Gene_locus related to this paper: human-CEL

Title : An intracellular role for pancreatic bile salt-dependent lipase: evidence for modification of lipid turnover in transfected CHO cells - Le Petit-Thevenin_1998_Biochim.Biophys.Acta_1393_307
Author(s) : Le Petit-Thevenin J , Bruneau N , Nobili O , Lombardo D , Verine A
Ref : Biochimica & Biophysica Acta , 1393 :307 , 1998
Abstract : Le Petit-Thevenin_1998_Biochim.Biophys.Acta_1393_307
ESTHER : Le Petit-Thevenin_1998_Biochim.Biophys.Acta_1393_307
PubMedSearch : Le Petit-Thevenin_1998_Biochim.Biophys.Acta_1393_307
PubMedID: 9748640
Gene_locus related to this paper: human-CEL

Title : Molecular cloning of the oncofetal isoform of the human pancreatic bile salt-dependent lipase - Pasqualini_1998_J.Biol.Chem_273_28208
Author(s) : Pasqualini E , Caillol N , Panicot L , Mas E , Lloubes R , Lombardo D
Ref : Journal of Biological Chemistry , 273 :28208 , 1998
Abstract : Pasqualini_1998_J.Biol.Chem_273_28208
ESTHER : Pasqualini_1998_J.Biol.Chem_273_28208
PubMedSearch : Pasqualini_1998_J.Biol.Chem_273_28208
PubMedID: 9774442
Gene_locus related to this paper: human-CEL

Title : Established and Emerging Strategies for Inhibition of Cholesterol Absorption - Homan_1997_Curr.Pharma.Design_3_29
Author(s) : Homan R , Krause BR
Ref : Curr.Pharma.Design , 3 :29 , 1997
Abstract : Homan_1997_Curr.Pharma.Design_3_29
ESTHER : Homan_1997_Curr.Pharma.Design_3_29
PubMedSearch : Homan_1997_Curr.Pharma.Design_3_29
PubMedID:
Gene_locus related to this paper: human-CEL , ratno-balip , mesau-a0a1u8cxs4

Title : O-Glycosylation of C-terminal tandem-repeated sequences regulates the secretion of rat pancreatic bile salt-dependent lipase - Bruneau_1997_J.Biol.Chem_272_27353
Author(s) : Bruneau N , Nganga A , Fisher EA , Lombardo D
Ref : Journal of Biological Chemistry , 272 :27353 , 1997
Abstract : Bruneau_1997_J.Biol.Chem_272_27353
ESTHER : Bruneau_1997_J.Biol.Chem_272_27353
PubMedSearch : Bruneau_1997_J.Biol.Chem_272_27353
PubMedID: 9341186
Gene_locus related to this paper: human-CEL

Title : Purification of carboxyl ester lipase (bile salt-stimulated lipase) from human milk and pancreas -
Author(s) : Blackberg L , Duan RD , Sternby B
Ref : Methods Enzymol , 284 :185 , 1997
PubMedID: 9379934
Gene_locus related to this paper: human-CEL

Title : Molecular biology of enzymes involved with cholesterol ester hydrolysis in mammalian tissues -
Author(s) : Hui DY
Ref : Biochimica & Biophysica Acta , 1303 :1996 , 1996
PubMedID: 8816847
Gene_locus related to this paper: human-CEL

Title : Chaperone function of a Grp 94-related protein for folding and transport of the pancreatic bile salt-dependent lipase - Bruneau_1995_J.Biol.Chem_270_13524
Author(s) : Bruneau N , Lombardo D
Ref : Journal of Biological Chemistry , 270 :13524 , 1995
Abstract : Bruneau_1995_J.Biol.Chem_270_13524
ESTHER : Bruneau_1995_J.Biol.Chem_270_13524
PubMedSearch : Bruneau_1995_J.Biol.Chem_270_13524
PubMedID: 7768954
Gene_locus related to this paper: human-CEL

Title : Isolation and characterization of human milk bile salt-activated lipase C-tail fragment - Wang_1995_Biochemistry_34_10639
Author(s) : Wang CS , Dashti A , Jackson KW , Yeh JC , Cummings RD , Tang J
Ref : Biochemistry , 34 :10639 , 1995
Abstract : Wang_1995_Biochemistry_34_10639
ESTHER : Wang_1995_Biochemistry_34_10639
PubMedSearch : Wang_1995_Biochemistry_34_10639
PubMedID: 7654718
Gene_locus related to this paper: human-CEL

Title : Expression of a 46 kDa protein in human pancreatic tumors and its possible relationship with the bile salt-dependent lipase - Roudani_1994_Eur.J.Cell.Biol_65_132
Author(s) : Roudani S , Pasqualini E , Margotat A , Gastaldi M , Sbarra V , Malezet-Desmoulin C , Lombardo D
Ref : European Journal of Cell Biology , 65 :132 , 1994
Abstract : Roudani_1994_Eur.J.Cell.Biol_65_132
ESTHER : Roudani_1994_Eur.J.Cell.Biol_65_132
PubMedSearch : Roudani_1994_Eur.J.Cell.Biol_65_132
PubMedID: 7889983
Gene_locus related to this paper: human-CEL

Title : Human fetoacinar pancreatic protein: an oncofetal glycoform of the normally secreted pancreatic bile-salt-dependent lipase - Mas_1993_Biochem.J_289 ( Pt 2)_609
Author(s) : Mas E , Abouakil N , Roudani S , Miralles F , Guy-Crotte O , Figarella C , Escribano MJ , Lombardo D
Ref : Biochemical Journal , 289 ( Pt 2) :609 , 1993
Abstract : Mas_1993_Biochem.J_289 ( Pt 2)_609
ESTHER : Mas_1993_Biochem.J_289 ( Pt 2)_609
PubMedSearch : Mas_1993_Biochem.J_289 ( Pt 2)_609
PubMedID: 8424803
Gene_locus related to this paper: human-CEL

Title : Bile salt-activated lipase. A multiple function lipolytic enzyme -
Author(s) : Wang CS , Hartsuck JA
Ref : Biochimica & Biophysica Acta , 1166 :1 , 1993
PubMedID: 8431483
Gene_locus related to this paper: human-CEL

Title : Bile salt-stimulated lipase in human milk. Evidence that bile salt induces lipid binding and activation via binding to different sites - Blackberg_1993_FEBS.Lett_323_207
Author(s) : Blackberg L , Hernell O
Ref : FEBS Letters , 323 :207 , 1993
Abstract : Blackberg_1993_FEBS.Lett_323_207
ESTHER : Blackberg_1993_FEBS.Lett_323_207
PubMedSearch : Blackberg_1993_FEBS.Lett_323_207
PubMedID: 8500612
Gene_locus related to this paper: human-CEL

Title : The human carboxyl ester lipase-like (CELL) gene is ubiquitously expressed and contains a hypervariable region - Nilsson_1993_Genomics_17_416
Author(s) : Nilsson J , Hellquist M , Bjursell G
Ref : Genomics , 17 :416 , 1993
Abstract : Nilsson_1993_Genomics_17_416
ESTHER : Nilsson_1993_Genomics_17_416
PubMedSearch : Nilsson_1993_Genomics_17_416
PubMedID: 7691717
Gene_locus related to this paper: human-CEL

Title : Genomic organization, sequence analysis, and chromosomal localization of the human carboxyl ester lipase (CEL) gene and a CEL-like (CELL) gene - Lidberg_1992_Genomics_13_630
Author(s) : Lidberg U , Nilsson J , Stromberg K , Stenman G , Sahlin P , Enerback S , Bjursell G
Ref : Genomics , 13 :630 , 1992
Abstract : Lidberg_1992_Genomics_13_630
ESTHER : Lidberg_1992_Genomics_13_630
PubMedSearch : Lidberg_1992_Genomics_13_630
PubMedID: 1639390
Gene_locus related to this paper: human-CEL

Title : Structure of the human pancreatic cholesterol esterase gene - Kumar_1992_Biochemistry_31_6077
Author(s) : Kumar BV , Aleman-Gomez JA , Colwell N , Lopez-Candales A , Bosner MS , Spilburg CA , Lowe M , Lange LG
Ref : Biochemistry , 31 :6077 , 1992
Abstract : Kumar_1992_Biochemistry_31_6077
ESTHER : Kumar_1992_Biochemistry_31_6077
PubMedSearch : Kumar_1992_Biochemistry_31_6077
PubMedID: 1627550
Gene_locus related to this paper: human-CEL

Title : cDNA cloning of carboxyl ester lipase from human pancreas reveals a unique proline-rich repeat unit - Reue_1991_J.Lipid.Res_32_267
Author(s) : Reue K , Zambaux J , Wong H , Lee G , Leete TH , Ronk M , Shively JE , Sternby B , Borgstrom B , Ameis D , Schotz MC
Ref : J Lipid Res , 32 :267 , 1991
Abstract : Reue_1991_J.Lipid.Res_32_267
ESTHER : Reue_1991_J.Lipid.Res_32_267
PubMedSearch : Reue_1991_J.Lipid.Res_32_267
PubMedID: 2066663
Gene_locus related to this paper: human-CEL

Title : Structure of human milk bile salt activated lipase - Baba_1991_Biochemistry_30_500
Author(s) : Baba T , Downs D , Jackson KW , Tang J , Wang CS
Ref : Biochemistry , 30 :500 , 1991
Abstract : Baba_1991_Biochemistry_30_500
ESTHER : Baba_1991_Biochemistry_30_500
PubMedSearch : Baba_1991_Biochemistry_30_500
PubMedID: 1988041
Gene_locus related to this paper: human-CEL

Title : Human milk bile-salt stimulated lipase. Sequence similarity with rat lysophospholipase and homology with the active site region of cholinesterases - Christie_1991_FEBS.Lett_278_190
Author(s) : Christie DL , Cleverly DR , O'Connor CJ
Ref : FEBS Letters , 278 :190 , 1991
Abstract : Christie_1991_FEBS.Lett_278_190
ESTHER : Christie_1991_FEBS.Lett_278_190
PubMedSearch : Christie_1991_FEBS.Lett_278_190
PubMedID: 1991511
Gene_locus related to this paper: human-CEL

Title : Carboxyl ester lipase: a highly polymorphic locus on human chromosome 9qter - Taylor_1991_Genomics_10_425
Author(s) : Taylor AK , Zambaux JL , Klisak I , Mohandas T , Sparkes RS , Schotz MC , Lusis AJ
Ref : Genomics , 10 :425 , 1991
Abstract : Taylor_1991_Genomics_10_425
ESTHER : Taylor_1991_Genomics_10_425
PubMedSearch : Taylor_1991_Genomics_10_425
PubMedID: 1676983
Gene_locus related to this paper: human-CEL

Title : Sequence identity between human pancreatic cholesterol esterase and bile salt-stimulated milk lipase - Hui_1990_FEBS.Lett_276_131
Author(s) : Hui DY , Kissel JA
Ref : FEBS Letters , 276 :131 , 1990
Abstract : Hui_1990_FEBS.Lett_276_131
ESTHER : Hui_1990_FEBS.Lett_276_131
PubMedSearch : Hui_1990_FEBS.Lett_276_131
PubMedID: 2265692
Gene_locus related to this paper: human-CEL

Title : cDNA cloning of human-milk bile-salt-stimulated lipase and evidence for its identity to pancreatic carboxylic ester hydrolase - Nilsson_1990_Eur.J.Biochem_192_543
Author(s) : Nilsson J , Blackberg L , Carlsson P , Enerback S , Hernell O , Bjursell G
Ref : European Journal of Biochemistry , 192 :543 , 1990
Abstract : Nilsson_1990_Eur.J.Biochem_192_543
ESTHER : Nilsson_1990_Eur.J.Biochem_192_543
PubMedSearch : Nilsson_1990_Eur.J.Biochem_192_543
PubMedID: 1698625
Gene_locus related to this paper: human-CEL