Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: anoga-ebiG8504

Anopheles gambiae str. PEST CRA_x54KRFTDC6T, ebiG8504 gene

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Anopheles gambiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Nematocera: N E > Culicomorpha: N E > Culicoidea: N E > Culicidae: N E > Anophelinae: N E > Anopheles [genus]: N E > Cellia: N E > Pyretophorus: N E > gambiae species complex: N E > Anopheles gambiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AAAB01008987, CR954257
1 UniProt : Q4JSA2
1 Ncbi-nid : 19612317
1 Ncbi-pid : 21289533
2 UniProt : Q7PY30, Q4JSA2
2 Interpro : Q7PY30, Q4JSA2
2 Prodom : Q7PY30, Q4JSA2
2 Pfam : Q7PY30, Q4JSA2
2 PIRSF : Q7PY30, Q4JSA2
2 SUPERFAM : Q7PY30, Q4JSA2
Sequence
Graphical view for this peptide sequence: anoga-ebiG8504
Colored MSA for Carb_B_Arthropoda (raw)
MSTQNEPRALGIVLAFLSVLTLTLLPPVSSQSDPTRPIIDSPTGQVQGTT
ESCGLFCTYYSFKGIPYAEPPVGSLRFRNPVPRARWTGVRDGSNHGSECL
QVSVVPGQVRGGEDCLYLNIYTQQLVGLRPVMVWIHGGGYSINSGNSVDF
GPEKLVQDNVLLVTLNYRLGALGFLSTGDRYAAGNWGLKDCLQALRWVRS
NIAAFGGDPNSVTIFGNSAGAALVHLLVLTDAGAGLFHRAIAQSSTALVP
YAFQTRPRFYADRIASALGFGTDSSTYVERLRTVPAEQFVPFQEATVTIP
VPRFLRPLDFGPVVEPGDAPDEVIVRQRPIELIRTGAHRVPFLVGYTDLE
GAFFTALDNAIDPTVKGQFNANPHLFVPFFWNVGAGTAASSQISGAFREH
YWQSRPLDASLDYEWTVYQSDHMFAFAIDQTVRLHAQTTPAPLYYYQFAY
DGDLNLYKKLFGVQHPGAIHTDELPYLFHIPAAMLVPVSPDSHANTVSSR
VVRMWTNFARTGNPTPGQDALLQNVQWPTVGATGTGYLSIGHDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSTQNEPRALGIVLAFLSVLTLTLLPPVSSQSDPTRPIIDSPTGQVQGTT
ESCGLFCTYYSFKGIPYAEPPVGSLRFRNPVPRARWTGVRDGSNHGSECL
QVSVVPGQVRGGEDCLYLNIYTQQLVGLRPVMVWIHGGGYSINSGNSVDF
GPEKLVQDNVLLVTLNYRLGALGFLSTGDRYAAGNWGLKDCLQALRWVRS
NIAAFGGDPNSVTIFGNSAGAALVHLLVLTDAGAGLFHRAIAQSSTALVP
YAFQTRPRFYADRIASALGFGTDSSTYVERLRTVPAEQFVPFQEATVTIP
VPRFLRPLDFGPVVEPGDAPDEVIVRQRPIELIRTGAHRVPFLVGYTDLE
GAFFTALDNAIDPTVKGQFNANPHLFVPFFWNVGAGTAASSQISGAFREH
YWQSRPLDASLDYEWTVYQSDHMFAFAIDQTVRLHAQTTPAPLYYYQFAY
DGDLNLYKKLFGVQHPGAIHTDELPYLFHIPAAMLVPVSPDSHANTVSSR
VVRMWTNFARTGNPTPGQDALLQNVQWPTVGATGTGYLSIGHDL


References
    Title: Comparative analysis of BAC and whole genome shotgun sequences from an Anopheles gambiae region related to Plasmodium encapsulation
    Eiglmeier K, Wincker P, Cattolico L, Anthouard V, Holm I, Eckenberg R, Quesneville H, Jaillon O, Collins FH and Roth CW <2 more author(s)>
    Ref: Insect Biochemistry & Molecular Biology, 35:799, 2005 : PubMed

            

    Title: The genome sequence of the malaria mosquito Anopheles gambiae
    Holt RA, Subramanian GM, Halpern A, Sutton GG, Charlab R, Nusskern DR, Wincker P, Clark AG, Ribeiro JM and Hoffman SL <113 more author(s)>
    Ref: Science, 298:129, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer