(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Eukaryota: NE > Opisthokonta: NE > Fungi: NE > Dikarya: NE > Ascomycota: NE > saccharomyceta: NE > Pezizomycotina: NE > leotiomyceta: NE > Eurotiomycetes: NE > Eurotiomycetidae: NE > Eurotiales: NE > Aspergillaceae: NE > Aspergillus: NE > Aspergillus kawachii: NE
Canar_LipB : aspkw-g7xru4Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi) Lipase. Cutinase : aspkw-g7xj51Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi) Cutinase. Fungal_carboxylesterase_lipase : aspkw-g7x761Aspergillus kawachii (White koji mold) (Aspergillus awamori var. kawachi); Aspergillus luchuensis Carboxylesterase family protein, aspkw-g7xcc9Aspergillus kawachii (White koji mold) (Aspergillus awamori var. kawachi); Aspergillus niger Carboxylesterase, aspkw-g7xum1Aspergillus kawachii (White koji mold) (Aspergillus awamori var. kawachi); Aspergillus luchuensis Carboxylesterase, aspkw-g7xy77Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi); Aspergillus niger Carboxylesterase. Kynurenine-formamidase : aspkw-g7xr60Aspergillus kawachii (White koji mold) (Aspergillus awamori var. kawachi); Aspergillus luchuensis. N-formylkynurenine formamidase. MpaH : aspkw-g7xq95Aspergillus kawachii (White koji mold) (Aspergillus awamori var. kawachi); Aspergillus tubingensis; Aspergillus niger. Similar to toxin biosynthesis protein, aspkw-g7xzf8Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi). Toxin biosynthesis protein. Thiohydrolase : aspkw-g7xen3Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi). DltD N-terminal domain protein
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Aspergillus kawachii IFO 4308: N, E.
Aspergillus niger ATCC 1015: N, E.
Aspergillus niger CBS 513.88: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA SGSCKKLTFIFARGTTEIGNMGTVVGPEVASELASLTGNQVTVQGVNYPA DWEGNVSLGSSGGPTMASYVKEALQQCPNTKVVLGGYSQGSMVVHYAANQ LSADQLSGAVLFGDPLKMEGVGKLSSSKVKEFCASGDPVCENGVNVMAHL TYGSDAKEAAQFLVQAAGVSSS
The filamentous fungus Aspergillus niger exhibits great diversity in its phenotype. It is found globally, both as marine and terrestrial strains, produces both organic acids and hydrolytic enzymes in high amounts, and some isolates exhibit pathogenicity. Although the genome of an industrial enzyme-producing A. niger strain (CBS 513.88) has already been sequenced, the versatility and diversity of this species compel additional exploration. We therefore undertook whole-genome sequencing of the acidogenic A. niger wild-type strain (ATCC 1015) and produced a genome sequence of very high quality. Only 15 gaps are present in the sequence, and half the telomeric regions have been elucidated. Moreover, sequence information from ATCC 1015 was used to improve the genome sequence of CBS 513.88. Chromosome-level comparisons uncovered several genome rearrangements, deletions, a clear case of strain-specific horizontal gene transfer, and identification of 0.8 Mb of novel sequence. Single nucleotide polymorphisms per kilobase (SNPs/kb) between the two strains were found to be exceptionally high (average: 7.8, maximum: 160 SNPs/kb). High variation within the species was confirmed with exo-metabolite profiling and phylogenetics. Detailed lists of alleles were generated, and genotypic differences were observed to accumulate in metabolic pathways essential to acid production and protein synthesis. A transcriptome analysis supported up-regulation of genes associated with biosynthesis of amino acids that are abundant in glucoamylase A, tRNA-synthases, and protein transporters in the protein producing CBS 513.88 strain. Our results and data sets from this integrative systems biology analysis resulted in a snapshot of fungal evolution and will support further optimization of cell factories based on filamentous fungi.
The filamentous fungus Aspergillus kawachii has traditionally been used for brewing the Japanese distilled spirit shochu. A. kawachii characteristically hyperproduces citric acid and a variety of polysaccharide glycoside hydrolases. Here the genome sequence of A. kawachii IFO 4308 was determined and annotated. Analysis of the sequence may provide insight into the properties of this fungus that make it superior for use in shochu production, leading to the further development of A. kawachii for industrial applications.
The filamentous fungus Aspergillus niger is widely exploited by the fermentation industry for the production of enzymes and organic acids, particularly citric acid. We sequenced the 33.9-megabase genome of A. niger CBS 513.88, the ancestor of currently used enzyme production strains. A high level of synteny was observed with other aspergilli sequenced. Strong function predictions were made for 6,506 of the 14,165 open reading frames identified. A detailed description of the components of the protein secretion pathway was made and striking differences in the hydrolytic enzyme spectra of aspergilli were observed. A reconstructed metabolic network comprising 1,069 unique reactions illustrates the versatile metabolism of A. niger. Noteworthy is the large number of major facilitator superfamily transporters and fungal zinc binuclear cluster transcription factors, and the presence of putative gene clusters for fumonisin and ochratoxin A synthesis.
