(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Eukaryota: NE > Opisthokonta: NE > Fungi: NE > Dikarya: NE > Ascomycota: NE > saccharomyceta: NE > Pezizomycotina: NE > leotiomyceta: NE > Eurotiomycetes: NE > Eurotiomycetidae: NE > Eurotiales: NE > Aspergillaceae: NE > Aspergillus: NE > Aspergillus niger: NE
6_AlphaBeta_hydrolase : aspnc-a2qbd3Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical protein SC4B10.33 - Streptomyces coelicolor, aspnc-a2qdj6Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical protein F17H10.1 -Caenorhabditis elegans, aspnc-a2qh52Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical protein mll2018 - Mesorhizobium loti, aspnc-a2qib2Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An04g02910, aspnc-a2qlz0Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An07g00200, aspnc-a2qnw9Aspergillus niger (strain CBS 513.88 / FGSC A1513) Function: R. opacus pcaL is involved in the degradation of aromatic compounds, aspnc-a2qwz6Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An11g07020, aspnc-a2r0u0Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to alkyl salicylate esterase salE - Acinetobacter sp., aspnc-a2r1p3Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: 3-Oxoadipate enol-lactone + H2O = 3-Oxoadipate, aspnc-a2r6g3Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to alkyl salicylate esterase salE - Acinetobacter sp., aspnc-a2r9y8Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical esterase SCD10.24 - Streptomyces coelicolor, aspnc-a2r032Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An12g07180, aspnc-a2r040Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical protein SC4B10.22 - Streptomyces coelicolor, aspnc-a2ra07Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An18g00910, aspnc-a2rap4Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An18g03880, aspnc-a2rav1Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: an epoxide + H(2)O <=> a glycol, aspnc-a5aaf4Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity: similarity to esterases and lipases, aspnc-a5ab63Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An08g09180, aspnc-a5abf0Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An11g00150, aspnc-a5abt2Aspergillus niger (strain CBS 513.88 / FGSC A1513) Contig An11c0340, complete genome. A85-EsteraseD-FGH : aspnc-a2qms0Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An07g03100. A85-Feruloyl-Esterase : aspnc-a2r6h8Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An16g00060. ABHD11-Acetyl_transferase : aspna-g3xsl3Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7). Uncharacterized protein. ABHD13-BEM46 : aspna-g3xpw9Aspergillus niger; Aspergillus brasiliensis; Aspergillus welwitschiae; Aspergillus eucalypticola; Aspergillus tubingensis; Aspergillus lacticoffeatus. Catalytic protein. abh_upf0017 : aspnc-a2r4j8Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An15g00670. Acetylxylan_esterase : aspnc-a2qt47Aspergillus niger Aspergillus kawachii,Catalytic activity: axe1 cleaves acetyl side chain groups from acetyl xylan, aspnc-a2qt66Aspergillus niger Catalytic activity: deacetylation of xylans and xylo-oligosaccharides AnCE5. Acidic_Lipase : aspnc-a2qn29Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: triacylglycerol + H2O = diacylglycerol + a fatty acid anion, aspnc-a5abz1Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An15g03950. Arb2_domain : aspna-g3y5a6Aspergillus niger; Aspergillus brasiliensis; A. neoniger; A. kawachii; A. luchuensis; A. vadensis; A. tubingensis; A. eucalypticola; A. welwitschiae; A. phoenicis; A. lacticoffeatus; A. luchuensis; A. awamori. Histone deacetylase Arb2 domain. Bacterial_esterase : aspnc-a2ql23Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An05g02280. BD-FAE : aspnc-a2qzx0Aspergillus niger Putative uncharacterized protein (EC 3.1.1.1), aspng-a2qzk9Aspergillus niger (EC 3.1.1.-). Canar_LipB : aspna-g3xpq9Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSH Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) Uncharacterized protein, aspnc-a2r199Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An13g00480. Carboxypeptidase_S10 : aspna-g3y4g9Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSH Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) Uncharacterized protein, aspng-pepfAspergillus niger pepF gene, aspsa-pepsAspergillus saitoi and Aspergillus niger carboxypeptidase, aspnc-kex1Aspergillus niger (strain CBS 513.88 / FGSC A1513). Carboxypeptidase D, aspnc-cbpyaAspergillus niger (strain CBS 513.88 / FGSC A1513). Carboxypeptidase Y homolog A. CFTR-inhibitory-factor_Cif : aspnc-a2qh85Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: cEH of C. sp. acts on epoxides. CGI-58_ABHD5_ABHD4 : aspnc-a2q814Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An01g02690. Cutinase : aspnc-cuti1Aspergillus niger Cut1 Cutinase Cutin hydrolase 1, aspnc-cuti2Aspergillus niger, Aspergillus kawachii, Cut2, Cutinase Cutin hydrolase 2. DPP4N_Peptidase_S9 : aspng-DAPBAspergillus niger dipeptidyl aminopeptidase type IV (EC 3.4.14.5). Duf_726 : aspnc-a2qbx7Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similar predicted ORFs, aspnc-a2raq2Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical protein YFL034w - Saccharomyces cerevisiae. Duf_829 : aspng-a2q8w0Aspergillus niger Contig An01c0200, complete genome, aspng-a2r0p8Aspergillus niger Similarity to hypothetical protein PaxU -Penicillium paxilli, aspng-a2r225Aspergillus niger Contig An13c0090, complete genome. Duf_900 : aspnc-a5abc6Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical protein encoded by An02g10630 - Aspergillus niger. Duf_1100-S : aspnc-a2r3s8Aspergillus niger (strain CBS 513.88 / FGSC A1513) Function: ayg1 of A. fumigatus has an unknown function. Duf_1749 : aspnc-a2qgj6Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity: the ORF shows strong similarity to the A. niger protein An16g04320, aspnc-a2r7q1Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An16g04320. Duf_2235 : aspnc-a2qbp6Aspergillus niger (strain CBS 513.88 / FGSC A1513). Similarity to hypothetical protein PA2063 - Pseudomonas aeruginosa. Epoxide_hydrolase : aspnc-a2qb93Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: an epoxide + H(2)O <=> a glycol, aspnc-a2qk14Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An04g09000, aspnc-a2qn70Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: epoxide hydrolases convert an epoxide + H(2)O to a glycol, aspng-q1ktb6Aspergillus niger epoxide hydrolase (EC 3.3.2.3), aspng-q1ktb5 Aspergillus usamii; Aspergillus niger; Aspergillus lacticoffeatus; Aspergillus brasiliensis AuEH2 Microsomal epoxide hyddrolase (EC 3.3.2.3), aspni-hyl1 Aspergillus niger hyl1 gene, exons 1-9. Esterase_phb : aspnc-axe1Aspergillus niger; Aspergillus ficuum Porbable acetylxylan esterase A, aspng-a0a100iph2Aspergillus niger; Aspergillus tubingensis. Acetylxylan esterase A. FaeC : aspnc-faecAspergillus niger; Aspergillus lacticoffeatus; Aspergillus phoenicis; Aspergillus welwitschiae; Aspergillus awamori; Aspergillus brasiliensis Ferulic acid esterase C. FSH1 : aspna-azacAspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7). Azaphilone biosynthesis cluster protein azaC. Fungal-Bact_LIP : aspnc-a2qm14Aspergillus niger (strain CBS 513.88 / FGSC A1513) Catalytic activity: triacylglycerol + H2O = diacylglycerol + a carboxylate. Fungal_carboxylesterase_lipase : aspna-g3yal2Aspergillus niger Aspergillus kawachii Putative uncharacterized protein An03g06630 Carboxylesterase (EC 3.1.1.3), aspna-g3ycq2Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSH Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) Carboxylesterase, aspnc-a2qbh3Aspergillus niger Carboxylesterase (EC 3.1.1.-), aspnc-a2qe77Aspergillus niger Aspergillus kawachii Carboxyesterase (EC 3.1.1.3), aspnc-a2qf54Aspergillus niger Aspergillus kawachii Carboxylesterase precursor (EC 3.1.1.-), aspnc-a2qfe9Aspergillus niger Aspergillus kawachii Carboxylesterase precursor (EC 3.1.1.41), aspnc-a2qg33Aspergillus niger Carboxylesterase (EC 3.1.1.-), aspnc-a2qh76Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2qhe2Aspergillus niger Aspergillus kawachii; Aspergillus luchuensis Putative uncharacterized protein (EC 3.1.1.3), aspnc-a2qi32Aspergillus niger Aspergillus kawachii Carboxylesterase Putative uncharacterized protein An04g02100, aspnc-a2ql89Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.1), aspnc-a2ql90Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.3) Putative uncharacterized protein An06g00350, aspnc-a2qla0Aspergillus niger; Aspergillus kawachii; Aspergillus luchuensis Putative uncharacterized protein An06g00460 Carboxylesterase (EC 3.1.1.8), aspnc-a2qmk5Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.1), aspnc-a2qn56Aspergillus niger Aspergillus kawachii Chlorogenic acid esterase Putative uncharacterized protein An07g04470 Carboxylesterase, aspnc-a2qs22Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2qti9Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.3), aspnc-a2qtz0Aspergillus niger Aspergillus kawachii Catalytic activity:Triacylglycerol + H2O = Diacylglycerol + a carboxylate (EC 3.1.1.3), aspnc-a2quc1Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.3), aspnc-a2qx92Aspergillus niger, Aspergillus kawachii precursor (EC 3.1.1.7), aspnc-a2qyf0Aspergillus niger Aspergillus kawachii Carboxylesterase, aspnc-a2qys7Aspergillus niger Aspergillus kawachii; Aspergillus luchuensis Carboxylesterase (EC 3.1.1.-), aspnc-a2qz72Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2qzn6Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2qzr0Aspergillus niger Aspergillus kawachii putative Carboxylesterase (EC 3.1.1.1), aspnc-a2r0p4Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2r1r5Aspergillus niger Carboxylesterase (EC 3.1.1.1), aspnc-a2r2i5Aspergillus niger Aspergillus kawachii; Aspergillus luchuensis Carboxylesterase (EC 3.1.1.3), aspnc-a2r5r4Aspergillus niger Aspergillus kawachii Putative uncharacterized protein (EC 3.1.1.1), aspnc-a2r6h5Aspergillus niger catalytic activity: esterase 2 (EC 3.1.-.-), aspnc-a2r8r3Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2r8z3Aspergillus niger Aspergillus kawachii precursor (EC 3.1.1.3), aspnc-a2r273Aspergillus niger; Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2r496Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a2r502Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.3), aspnc-a5abe5Aspergillus niger Aspergillus kawachii Carboxylesterase (EC 3.1.1.-), aspnc-a5abe8Aspergillus niger Aspergillus kawachii similar to pnb Carboxylesterase(EC 3.1.1.-), aspnc-a5abh9Aspergillus niger Aspergillus kawachii Carboxylesterase(EC 3.1.1.-), aspnc-a5abk1Aspergillus niger Aspergillus kawachii contig an11c0010, complete genome. (EC 3.1.1.-), aspng-a2qs46Aspergillus niger Catalytic activity: Triacylglycerol + H2O = Diacylglycerol + a carboxylate precursor (EC 3.1.1.3) (ec 3.1.1.41), aspng-a2qst4Aspergillus niger Aspergillus kawachii Catalytic activity: cephalosporin C + H2O = deacetylcephalosporin C + acetate precursor (EC 3.1.1.41), aspng-a2qv27Aspergillus niger Carboxylesterase (EC 3.1.1.-), aspni-EstA Aspergillus niger Aspergillus kawachii Carboxylesterase EstA (EC 3.1.1.3) (ec 3.1.1.41), aspng-a0a100i841Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a100i860Aspergillus niger; Aspergillus luchuensis, EstA, aspng-a0a100ie01Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a100ieg8Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a100ifw6Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a100ig15Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a100ig19Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a100iin7Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a100iip6Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a100ijp7Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a100iks1Aspergillus niger; Aspergillus luchuensis, Acetylcholinesterase, aspng-a0a100ils5Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a100im87Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a100imq6Aspergillus niger, Lipase, aspng-a0a100ipx4Aspergillus niger, Pc21g22430, aspng-a0a100ipy0Aspergillus niger, Carboxylesterase, aspng-a0a100iq47Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a100iqq3Aspergillus niger, Carboxylesterase, aspng-a0a100iu10Aspergillus niger, Carboxylesterase, aspng-a0a117dx77Aspergillus niger; Aspergillus luchuensis, Carboxylic ester hydrolase, aspng-a0a117dz65Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a117e043Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a117e0s5Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a117e335Aspergillus niger, Carboxylesterase, aspng-a0a117e396Aspergillus niger, Carboxylic ester hydrolase, aspng-a0a117e3u0Aspergillus niger, Carboxylesterase family protein, aspng-a0a124by93Aspergillus niger, Carboxylesterase, aspng-a0a124byn7Aspergillus niger, Carboxylic ester hydrolase. Haloalkane_dehalogenase-HLD1 : aspnc-a2r4c0Aspergillus nige Catalytic Epoxide hydrolase. Haloperoxidase : aspnc-a2qt50Aspergillus niger (strain CBS 513.88 / FGSC A1513) Contig An09c0040, complete genome. Kynurenine-formamidase : aspnc-a2qqa1Aspergillus niger N-formylkynurenine formamidase, aspng-a0a117e0n8Aspergillus niger, Kynurenine formamidase, KFA, KFase, Arylformamidase, N-formylkynurenine formamidase, FKF. LIDHydrolase : aspnc-a2qgm6Aspergillus niger (strain CBS 513.88 / FGSC A1513) Similarity to hypothetical membrane protein YPR147c - Saccharomyces cerevisiae. Lipase_3 : aspng-EXANL1Aspergillus niger sn-1, 3 Extracellular lipase EXANL1 PEXANL1, aspnc-atg15Aspergillus niger (strain CBS 513.88 / FGSC A1513) Autophagy-related protein 15, aspni-FAEA Aspergillus niger; A. usamii; A. phoenicis ; A. awamori; A. welwitschiae; A. vadensis; A. lacticoffeatus; A. phoenicis ferulic acid esterase a, AnFAEA. Monoglyceridelipase_lysophospholip : aspnc-a2qw06Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An11g03380. MpaH : aspnc-a2qw57Aspergillus niger; Aspergillus awamori (Black koji mold); Aspergillus welwitschiae. Aspergillus niger contig An11c0150, genomic contig, aspng-a0a100iew6Aspergillus niger. Toxin biosynthesis protein. PAF-Acetylhydrolase : aspnc-a2qt70Aspergillus niger (strain CBS 513.88 / FGSC A1513). Aspergillus niger contig An09c0040, genomic contig. PMH_Peptidase_S9 : aspni-APSCAspergillus niger aminopeptidase c, Putative uncharacterized protein An04g02850. PPase_methylesterase_euk : aspnc-a2q8r7Aspergillus niger (strain CBS 513.88 / FGSC A1513) Protein phosphatase methylesterase 1. Proline_iminopeptidase : aspni-PAPAAspergillus niger prolyl aminopeptidase a (EC 3.4.11.5), aspnc-a2r871Aspergillus niger (strain CBS 513.88 / FGSC A1513). Function: PIP of B. coagulans has a higher activity toward small peptides. Prolylcarboxypeptidase : aspnc-a2qr21 Aspergillus niger (strain CBS 513.88 / FGSC A1513) Endoprotease Endo-Pro-Aspergillus niger, aspnc-a2qzs1Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An12g05960, aspnc-a2r2l0Aspergillus niger (strain CBS 513.88 / FGSC A1513) Putative uncharacterized protein An14g01120. Prolyl_oligopeptidase_S9 : aspng-DPP5Aspergillus niger, dipeptidyl peptidase V. Tannase : aspnc-a2qir3 Aspergillus niger Carboxylic ester hydrolase Tannase An04g04430 An-Tan, aspng-faebAspergillus niger (and strain CBS 513.88 / FGSC A1513) (faeb) (fae-i) (cinnamoyl esterase) (cinnae), aspng-q3s2a9Aspergillus niger tannase (fragment), aspnc-a2r9c0Aspergillus niger (strain CBS 513.88 / FGSC A1513) Carboxylic ester hydrolase, aspng-a0a124bxs8.2Aspergillus niger, Tannase. Thioesterase : aspnc-pyniAspergillus niger (strain CBS 513.88 / FGSC A1513). Pyranonigrin biosynthesis cluster protein I, aspna-albaAspergillus niger. Non-reducing polyketide synthase albA. Thioesterase last domain. Thiohydrolase : aspng-a0a100i8t9Aspergillus niger; Aspergillus tubingensis. AB hydrolase-1 domain-containing protein
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Aspergillus niger CBS 513.88: N, E.
Aspergillus niger ATCC 1015: N, E.
Aspergillus lacticoffeatus CBS 101883: N, E.
Aspergillus niger ATCC 13496: N, E.
Aspergillus kawachii IFO 4308: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MFVSSLALLALIAPLIAIAVKIEQPGINPNPTATVRNGTYYGLHNQHYNQ DLFLGIPYAQQPIGDLRLRTPRSMNTSWPVPRNATEYSPACVGFNQTEGA SEACLTLNVVRPASIALSESLPVAVWIHGGGFTSGSSSEKQYNLSFIVDQ SVQMEKPVIAVSLNYRLQCWGFMWSKEMKEAGVGNLGLRDQRLALHWIQE NIAAFGGDPAQVTIWGESAGANSVGTHLVAYGGRDDGIFRAAISESGAPS VYQRYPTPAEWQPYYDGIVNASGCSSATDTLACLRTIPTNILHGIFDNTS IVPMHAISGLSGAKFIPVIDDDFIKESATVQLQKGNFVKVPYLIGANADE GTAFAVEGVNTDAEFRELVKGWGLNNATTDILEALYPDIPQIGIPAIMVG RPPSGYGNQYKRVAAFQGDVNIHAARRLTSQIWSSRNISVYSYMFDVISP GYGPSAGSYAGATHGTDIPYVFYNLDGLGYDSNNKSIESIPNSYSRMSKI MSRMWVSFVTTLDPNHSGGMVPHPIPMIAQCQTRAESTIFLGTNVQWPPY NIDNPEIIFFDTDVTNLTYTWPAGLYAHWW
The filamentous fungus Aspergillus niger exhibits great diversity in its phenotype. It is found globally, both as marine and terrestrial strains, produces both organic acids and hydrolytic enzymes in high amounts, and some isolates exhibit pathogenicity. Although the genome of an industrial enzyme-producing A. niger strain (CBS 513.88) has already been sequenced, the versatility and diversity of this species compel additional exploration. We therefore undertook whole-genome sequencing of the acidogenic A. niger wild-type strain (ATCC 1015) and produced a genome sequence of very high quality. Only 15 gaps are present in the sequence, and half the telomeric regions have been elucidated. Moreover, sequence information from ATCC 1015 was used to improve the genome sequence of CBS 513.88. Chromosome-level comparisons uncovered several genome rearrangements, deletions, a clear case of strain-specific horizontal gene transfer, and identification of 0.8 Mb of novel sequence. Single nucleotide polymorphisms per kilobase (SNPs/kb) between the two strains were found to be exceptionally high (average: 7.8, maximum: 160 SNPs/kb). High variation within the species was confirmed with exo-metabolite profiling and phylogenetics. Detailed lists of alleles were generated, and genotypic differences were observed to accumulate in metabolic pathways essential to acid production and protein synthesis. A transcriptome analysis supported up-regulation of genes associated with biosynthesis of amino acids that are abundant in glucoamylase A, tRNA-synthases, and protein transporters in the protein producing CBS 513.88 strain. Our results and data sets from this integrative systems biology analysis resulted in a snapshot of fungal evolution and will support further optimization of cell factories based on filamentous fungi.
The filamentous fungus Aspergillus kawachii has traditionally been used for brewing the Japanese distilled spirit shochu. A. kawachii characteristically hyperproduces citric acid and a variety of polysaccharide glycoside hydrolases. Here the genome sequence of A. kawachii IFO 4308 was determined and annotated. Analysis of the sequence may provide insight into the properties of this fungus that make it superior for use in shochu production, leading to the further development of A. kawachii for industrial applications.
The filamentous fungus Aspergillus niger is widely exploited by the fermentation industry for the production of enzymes and organic acids, particularly citric acid. We sequenced the 33.9-megabase genome of A. niger CBS 513.88, the ancestor of currently used enzyme production strains. A high level of synteny was observed with other aspergilli sequenced. Strong function predictions were made for 6,506 of the 14,165 open reading frames identified. A detailed description of the components of the protein secretion pathway was made and striking differences in the hydrolytic enzyme spectra of aspergilli were observed. A reconstructed metabolic network comprising 1,069 unique reactions illustrates the versatile metabolism of A. niger. Noteworthy is the large number of major facilitator superfamily transporters and fungal zinc binuclear cluster transcription factors, and the presence of putative gene clusters for fumonisin and ochratoxin A synthesis.