Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysj-q6yse8

Oryza sativa (japonica cultivar-group; subsp. indica (Rice)); O. glaberrima (African rice); O. brachyantha; Leersia perrieri; O. glumipatula; O. barthii; O. nivara (Indian wild rice) (O. sativa f. spontanea); O. rufipogon (Brownbeard rice) (Asian wild rice); O. meridionalis; O. punctata (Red rice) putative membrane protein

Comment
Other strains: Oryza sativa (japonica cultivar-group) Oryza sativa subsp. indica (Rice); Oryza glaberrima (African rice); Oryza brachyantha; Leersia perrieri; Oryza glumipatula; Oryza barthii; Oryza nivara (Indian wild rice) (Oryza sativa f. spontanea); Oryza rufipogon (Brownbeard rice) (Asian wild rice); Oryza meridionalis; Oryza punctata (Red rice)


Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: AP006458, CM000132, AP008213
>3 UniProt links 9 more: Q6YSE8, B8B8C4, I1QC28
>3 UniProt links 9 more: Q6YSE8, B8B8C4, I1QC28
>3 Interpro links 9 more: Q6YSE8, B8B8C4, I1QC28
>3 Prodom links 9 more: Q6YSE8, B8B8C4, I1QC28
>3 Pfam links 9 more: Q6YSE8, B8B8C4, I1QC28
>3 PIRSF links 9 more: Q6YSE8, B8B8C4, I1QC28
>3 SUPERFAM links 9 more: Q6YSE8, B8B8C4, I1QC28
Sequence
Graphical view for this peptide sequence: orysj-q6yse8
Colored MSA for ABHD13-BEM46 (raw)
MVGWLKALCYGAGGMAVVGLAALVALQERLVYVPVLPGIARAYPITPDRL
RLIYEDVWLRAADGVRLHSWFIRHSPTCRGPTILFFQENAGNIAHRLDFV
RLMMQRLQCNVFMLSYRGYGESDGYPSQKGIINDAQAALDHLVQRKDIDT
SRIVVFGRSLGGAVGAVLAKNNPGKVSALILENTFTSILDMAGIMLPFLR
WFIGGSSSKGPKLLNCVVRSPWSTLDIIAEVKQPIIFLSGLQDELVPPSH
MRLLYEKAFEHNKNCRFVDFPNGMHMDTWNSGGDRYWRTIQLFLDQYAPE
VQSCNTSCKSEIANDDEAEE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVGWLKALCYGAGGMAVVGLAALVALQERLVYVPVLPGIARAYPITPDRL
RLIYEDVWLRAADGVRLHSWFIRHSPTCRGPTILFFQENAGNIAHRLDFV
RLMMQRLQCNVFMLSYRGYGESDGYPSQKGIINDAQAALDHLVQRKDIDT
SRIVVFGRSLGGAVGAVLAKNNPGKVSALILENTFTSILDMAGIMLPFLR
WFIGGSSSKGPKLLNCVVRSPWSTLDIIAEVKQPIIFLSGLQDELVPPSH
MRLLYEKAFEHNKNCRFVDFPNGMHMDTWNSGGDRYWRTIQLFLDQYAPE
VQSCNTSCKSEIANDDEAEE


References
8 more
    Title: Whole-genome sequencing of Oryza brachyantha reveals mechanisms underlying Oryza genome evolution
    Chen J, Huang Q, Gao D, Wang J, Lang Y, Liu T, Li B, Bai Z, Luis Goicoechea J and Chen M <30 more author(s)>
    Ref: Nat Commun, 4:1595, 2013 : PubMed

            

    Title: The Genomes of Oryza sativa: a history of duplications
    Yu J, Wang J, Lin W, Li S, Li H, Zhou J, Ni P, Dong W, Hu S and Yang H <88 more author(s)>
    Ref: PLoS Biol, 3:e38, 2005 : PubMed

            

    Title: Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice
    Kikuchi S, Satoh K, Nagata T, Kawagashira N, Doi K, Kishimoto N, Yazaki J, Ishikawa M, Yamada H and Yasunishi A <64 more author(s)>
    Ref: Science, 301:376, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer