Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ratno-hyes

Rattus norvegicus (Rat) Bifunctional epoxide hydrolase 2, cytosolic epoxide hydrolase, Lipid-phosphate phosphatase

Comment
only c-term PfamA Abhydrolase_1 284 539 N-term HAD haloacid dehalogenase, D4A6V6 different in the middle errors?


Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Rattus norvegicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: X65083, 1802277A, X60328
2 UniProt : P80299, Q5RKK3
1 Ncbi-nid : 402631
1 Ncbi-pid : 402632
2 UniProt : P80299, Q5RKK3
2 Interpro : P80299, Q5RKK3
2 Pfam : P80299, Q5RKK3
2 PIRSF : P80299, Q5RKK3
2 SUPERFAM : P80299, Q5RKK3
Sequence
Graphical view for this peptide sequence: ratno-hyes
Colored MSA for Epoxide_hydrolase (raw)
HGYVTVKPGIRLHFVEMGSGPAICLCHGFPESWFSWRYQIPALAQAGFRV
LAIDMKGYGDSSSPPEIEEYAMELLCEEMVTFLNKLGIPQAVFIGHDWAG
VLVWNMALFHPERVRAVASLNTPLMPPNPEVSPMEVIRSIPVFNYQLYFQ
EPGVAEAELEKNMSRTFKSFFRTSDDMGLLTVNKATEMGGILVGTPEDPK
VSKITTEEEIEYYIQQFKKSGFRGPLNWYRNTERNWKWSCKALGRKILVP
ALMVTAEKDIVLRPEMSKNMENWIPFLKRGHIEDCGHWTQIEKPAEVNQI
LIKWLKTEIQNPSVTSKI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

HGYVTVKPGIRLHFVEMGSGPAICLCHGFPESWFSWRYQIPALAQAGFRV
LAIDMKGYGDSSSPPEIEEYAMELLCEEMVTFLNKLGIPQAVFIGHDWAG
VLVWNMALFHPERVRAVASLNTPLMPPNPEVSPMEVIRSIPVFNYQLYFQ
EPGVAEAELEKNMSRTFKSFFRTSDDMGLLTVNKATEMGGILVGTPEDPK
VSKITTEEEIEYYIQQFKKSGFRGPLNWYRNTERNWKWSCKALGRKILVP
ALMVTAEKDIVLRPEMSKNMENWIPFLKRGHIEDCGHWTQIEKPAEVNQI
LIKWLKTEIQNPSVTSKI


References
    Title: Genome sequence of the Brown Norway rat yields insights into mammalian evolution
    Gibbs RA, Weinstock GM, Metzker ML, Muzny DM, Sodergren EJ, Scherer S, Scott G, Steffen D, Worley KC and Collins F <218 more author(s)>
    Ref: Nature, 428:493, 2004 : PubMed

            

    Title: Isolation and characterization of a cDNA encoding rat liver cytosolic epoxide hydrolase and its functional expression in Escherichia coli
    Knehr M, Thomas H, Arand M, Gebel T, Zeller HD, Oesch F
    Ref: Journal of Biological Chemistry, 268:17623, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer