Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-ECM18

Saccharomyces cerevisiae (Baker's yeast) (and strains YJM789; AWRI1631; Lalvin EC1118 / Prise de mousse; RM11-1a; JAY291) hypothetical 53.2 kda extracellular matrix protein 18

Relationship
Family|CGI-58_ABHD5_ABHD4
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: Z48758, AAFW02000145, ABSV01000447
>3 UniProt links 3 more: Q04623, A6ZY87, B5VG21
>3 UniProt links 3 more: Q04623, A6ZY87, B5VG21
>3 Interpro links 3 more: Q04623, A6ZY87, B5VG21
>3 Prodom links 3 more: Q04623, A6ZY87, B5VG21
>3 Pfam links 3 more: Q04623, A6ZY87, B5VG21
>3 PIRSF links 3 more: Q04623, A6ZY87, B5VG21
>3 SUPERFAM links 3 more: Q04623, A6ZY87, B5VG21
1 SGD : S0002532
Sequence
Graphical view for this peptide sequence: yeast-ECM18
Colored MSA for CGI-58_ABHD5_ABHD4 (raw)
MLLIKRYLMDPESLRRQIMNVYKCYMWKRAFHSNRSLLEVKRREKSLQRK
ILERILRPKEENAVKKSGFKLWSSHLNNPHKTYMRLEELQRRIMEEVHVE
GIKKNDKLFNEINQWHFQNENTSTVRTPTLLIHGYAASSMSFFRNYPGLS
KHIRNLYSIDMPASGLSSVPSLEINTTTPLPLDIKFIGENKFKVPYTINA
NHNKFVIQMYEDFYLDRIEQWRIDNKLGKMNVVGHSFGGYLSFKYAVKYP
NSVNKLCLVSPLGVERNIWSVNNNFHSNTLYTIDFKNPNSKFYSKRNMIP
KYLFEQQFHILRMMGPLGAKLCWNYIMAAYSRVPSLAYKEYIFELFYGKG
GIPEVTTDIFKALFSRCILAKDPLMDSLQYLNVKKLLIVYGQYDWMNKKA
GMFMVKELNNLKNCLEGASYLEIPSSGHNLFLDNPESFNQSIVSFLSDET
KSP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLLIKRYLMDPESLRRQIMNVYKCYMWKRAFHSNRSLLEVKRREKSLQRK
ILERILRPKEENAVKKSGFKLWSSHLNNPHKTYMRLEELQRRIMEEVHVE
GIKKNDKLFNEINQWHFQNENTSTVRTPTLLIHGYAASSMSFFRNYPGLS
KHIRNLYSIDMPASGLSSVPSLEINTTTPLPLDIKFIGENKFKVPYTINA
NHNKFVIQMYEDFYLDRIEQWRIDNKLGKMNVVGHSFGGYLSFKYAVKYP
NSVNKLCLVSPLGVERNIWSVNNNFHSNTLYTIDFKNPNSKFYSKRNMIP
KYLFEQQFHILRMMGPLGAKLCWNYIMAAYSRVPSLAYKEYIFELFYGKG
GIPEVTTDIFKALFSRCILAKDPLMDSLQYLNVKKLLIVYGQYDWMNKKA
GMFMVKELNNLKNCLEGASYLEIPSSGHNLFLDNPESFNQSIVSFLSDET
KSP


References
5 more
    Title: Global analysis of protein localization in budding yeast
    Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK
    Ref: Nature, 425:686, 2003 : PubMed

            

    Title: The nucleotide sequence of Saccharomyces cerevisiae chromosome IV
    Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A and Zaccaria P <126 more author(s)>
    Ref: Nature, 387:75, 1997 : PubMed

            

    Title: Large scale identification of genes involved in cell surface biosynthesis and architecture in Saccharomyces cerevisiae
    Lussier M, White AM, Sheraton J, di Paolo T, Treadwell J, Southard SB, Horenstein CI, Chen-Weiner J, Ram AF and Bussey H <10 more author(s)>
    Ref: Genetics, 147:435, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer