Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-At3g50790

Arabidopsis thaliana (Mouse-ear cress) putative LEA protein At3g50790

Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AL049862, AY087566, AK175903
1 UniProt : Q680G4
3 UniProt : Q680G4, Q9SVL9, Q8LAW4
3 Interpro : Q680G4, Q9SVL9, Q8LAW4
3 Pfam : Q680G4, Q9SVL9, Q8LAW4
3 PIRSF : Q680G4, Q9SVL9, Q8LAW4
3 SUPERFAM : Q680G4, Q9SVL9, Q8LAW4
1 Tair database : At3g50790
Sequence
Graphical view for this peptide sequence: arath-At3g50790
Colored MSA for abh_upf0017 (raw)
MARVAFATSSPPLISSVRTLRRHFSVFAAANPEMSRPSHHSSLEVIGGGS
DRFLPSLKDSLAKPYNAFPLIGFNRHVETIYASFFRSVPFVRLRRECLRT
KDNGSVALDWVAGEDRHFPPDSPILILLPGLTGGSQDSYVRHMLLRAQSK
KWRCVVFNSRGCGDSPVTTPQFYSASFLGDIGEVIDHVVDKFPKANLYAA
GWSLGGNILVNYLGQESHNCPLTAAVSLCNPFDLVIADEDFHKGFNNVYD
KALSKSLRRIFSKHSLLFEDIGGEFNIPLAANAETVRDFDDGLTRVSFGF
KSVDEYYSKSSSSKAIKHVRIPLLCIQAANDPIAPERGIPRDDIKANPNC
VLIVTPRGGHLGWVAGEEAPNGAPWTDQVVMEFLQHVENRETINGERSFE
DVHDQIQV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARVAFATSSPPLISSVRTLRRHFSVFAAANPEMSRPSHHSSLEVIGGGS
DRFLPSLKDSLAKPYNAFPLIGFNRHVETIYASFFRSVPFVRLRRECLRT
KDNGSVALDWVAGEDRHFPPDSPILILLPGLTGGSQDSYVRHMLLRAQSK
KWRCVVFNSRGCGDSPVTTPQFYSASFLGDIGEVIDHVVDKFPKANLYAA
GWSLGGNILVNYLGQESHNCPLTAAVSLCNPFDLVIADEDFHKGFNNVYD
KALSKSLRRIFSKHSLLFEDIGGEFNIPLAANAETVRDFDDGLTRVSFGF
KSVDEYYSKSSSSKAIKHVRIPLLCIQAANDPIAPERGIPRDDIKANPNC
VLIVTPRGGHLGWVAGEEAPNGAPWTDQVVMEFLQHVENRETINGERSFE
DVHDQIQV


References
    Title: Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana
    Salanoubat M, Lemcke K, Rieger M, Ansorge W, Unseld M, Fartmann B, Valle G, Blocker H, Perez-Alonso M and Tabata S <127 more author(s)>
    Ref: Nature, 408:820, 2000 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer