arath-PLA12

 
Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) t20m3.6 protein At1g05800

Relationship
Block L
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : AC009999
2 UniProt : D7KF78, Q9MA46
2 UniProtTrembl : D7KF78, Q9MA46
2 Interpro : D7KF78, Q9MA46
2 Prodom : D7KF78, Q9MA46
2 Pfam : D7KF78, Q9MA46
2 PIRSF : D7KF78, Q9MA46
2 SUPERFAM : D7KF78, Q9MA46
2 QuickSwissBlast : D7KF78, Q9MA46
1 Tair database : At1g05805
 
Sequence
Graphical view for this peptide sequence: arath-PLA12
Colored MSA for Plant_phospholipase (raw)
MAAKVFTQNPIYSQSLVRDKTPQQKHNLDHFSISQHTSKRLVVSSSTMSP
PISSSPLSLPSSSSSQAIPPSRAPAVTLPLSRVWREIQGSNNWENLIEPL
SPILQQEITRYGNLLSASYKGFDLNPNSKRYLSCKYGKKNLLKESGIHDP
DGYQVTKYIYATPDINLNPIKNEPNRARWIGYVAVSSDESVKRLGRRDIL
VTFRGTVTNHEWLANLKSSLTPARLDPHNPRPDVKVESGFLGLYTSGESE
SKFGLESCREQLLSEISRLMNKHKGEEISITLAGHSMGSSLAQLLAYDIA
ELGMNQRRDEKPVPVTVFSFAGPRVGNLGFKKRCEELGVKVLRITNVNDP
ITKLPGFLFNENFRSLGGVYELPWSCSCYTHVGVELTLDFFDVQNISCVH
DLETYITLVNRPRCSKLAVNEDNFGGEFLNRTSELMFSKGRRQALHFTNA
ATNAAYLLCSISNHMLYYNIF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAKVFTQNPIYSQSLVRDKTPQQKHNLDHFSISQHTSKRLVVSSSTMSP
PISSSPLSLPSSSSSQAIPPSRAPAVTLPLSRVWREIQGSNNWENLIEPL
SPILQQEITRYGNLLSASYKGFDLNPNSKRYLSCKYGKKNLLKESGIHDP
DGYQVTKYIYATPDINLNPIKNEPNRARWIGYVAVSSDESVKRLGRRDIL
VTFRGTVTNHEWLANLKSSLTPARLDPHNPRPDVKVESGFLGLYTSGESE
SKFGLESCREQLLSEISRLMNKHKGEEISITLAGHSMGSSLAQLLAYDIA
ELGMNQRRDEKPVPVTVFSFAGPRVGNLGFKKRCEELGVKVLRITNVNDP
ITKLPGFLFNENFRSLGGVYELPWSCSCYTHVGVELTLDFFDVQNISCVH
DLETYITLVNRPRCSKLAVNEDNFGGEFLNRTSELMFSKGRRQALHFTNA
ATNAAYLLCSISNHMLYYNIF

no DNA




References
3 more
    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            

    Title: Cooperation and functional diversification of two closely related galactolipase genes for jasmonate biosynthesis
    Hyun Y, Choi S, Hwang HJ, Yu J, Nam SJ, Ko J, Park JY, Seo YS, Kim EY and Lee I <4 more author(s)>
    Ref: Dev Cell, 14:183, 2008 : PubMed

            

    Title: Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana
    Theologis A, Ecker JR, Palm CJ, Federspiel NA, Kaul S, White O, Alonso J, Altafi H, Araujo R and Davis RW <79 more author(s)>
    Ref: Nature, 408:816, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer