Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspna-g3xpw9

Aspergillus niger; Aspergillus brasiliensis; Aspergillus welwitschiae; Aspergillus eucalypticola; Aspergillus tubingensis; Aspergillus lacticoffeatus. Catalytic protein

Comment
Other strains: Aspergillus niger (ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7; CBS 513.88 / FGSC A1513); Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946); Aspergillus welwitschiae; Aspergillus eucalypticola (strain CBS 122712 / IBT 29274); Aspergillus tubingensis (strain CBS 134.48; Aspergillus lacticoffeatus (strain CBS 101883)


Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Aspergillus niger
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus niger: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: aspna-g3xpw9
Colored MSA for ABHD13-BEM46 (raw)
MSESPPPPSWSIAGMANSAVQFLRLPVLASSGLAVVASGLLYFKQNELIY
PRNVPVDARTNVPKPQQFGITDYEDLQIPTPDGESLHALFIRPSRKRIGQ
NITVLMFHGNAGNIGHRIPIAKVLQDVLGCNVLMLEYRGYGLSTGTPDET
GLKVDAQTGLEYIQQRPETRDSKIVVYGQSLGGAVAINLVANNQGNGAIA
GLILENTFLSIRKLIPTVFPPARYLARFCHQYWTSEDILPKITQVPILFL
SGLKDEIVPPSNMTQLFAICKSDRKVWRTLPNGGHNDSVAEPGYFEHILS
FVREEVLADGH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSESPPPPSWSIAGMANSAVQFLRLPVLASSGLAVVASGLLYFKQNELIY
PRNVPVDARTNVPKPQQFGITDYEDLQIPTPDGESLHALFIRPSRKRIGQ
NITVLMFHGNAGNIGHRIPIAKVLQDVLGCNVLMLEYRGYGLSTGTPDET
GLKVDAQTGLEYIQQRPETRDSKIVVYGQSLGGAVAINLVANNQGNGAIA
GLILENTFLSIRKLIPTVFPPARYLARFCHQYWTSEDILPKITQVPILFL
SGLKDEIVPPSNMTQLFAICKSDRKVWRTLPNGGHNDSVAEPGYFEHILS
FVREEVLADGH


References
1 more
    Title: Comparative genomics reveals high biological diversity and specific adaptations in the industrially and medically important fungal genus Aspergillus
    de Vries RP, Riley R, Wiebenga A, Aguilar-Osorio G, Amillis S, Uchima CA, Anderluh G, Asadollahi M, Askin M and Grigoriev IV <107 more author(s)>
    Ref: Genome Biol, 18:28, 2017 : PubMed

            

    Title: Draft Genome Sequence of Aspergillus niger Strain An76
    Gong W, Cheng Z, Zhang H, Liu L, Gao P, Wang L
    Ref: Genome Announc, 4:, 2016 : PubMed

            

    Title: Comparative genomics of citric-acid-producing Aspergillus niger ATCC 1015 versus enzyme-producing CBS 513.88
    Andersen MR, Salazar MP, Schaap PJ, van de Vondervoort PJ, Culley D, Thykaer J, Frisvad JC, Nielsen KF, Albang R and Baker SE <37 more author(s)>
    Ref: Genome Res, 21:885, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer