Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bovin-balip

Bos taurus (Bovine) Bos mutus (Yak) protein for bile-salt-activated lipase

Comment
Bile-salt-activated lipase precursor (EC 3.1.1.3) (EC 3.1.1.13) (BAL), Bile-salt-stimulated lipase (BSSL), Carboxyl ester lipase, Sterol esterase, Cholesterol esterase, Pancreatic lysophospholipase only n-term Pfam A COesterase 4 544


Relationship
Family|Cholesterol_esterase
Block| C
Position in NCBI Life Tree|Bos taurus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Ruminantia: N E > Pecora: N E > Bovidae: N E > Bovinae: N E > Bos: N E > Bos taurus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
>3 Genbank links 2 more: M28402, BT021633, BC149638
>3 UniProt links 1 more: P30122, Q58DG4, A6QQ45
1 Ncbi-nid : 598082
3 Structure : 1AKN, 1AQL, 2BCE
>3 UniProt links 1 more: Q58DG4, P30122, A6QQ45
>3 Interpro links 1 more: Q58DG4, P30122, A6QQ45
>3 Prodom links 1 more: Q58DG4, P30122, A6QQ45
>3 Pfam links 1 more: Q58DG4, P30122, A6QQ45
>3 PIRSF links 1 more: Q58DG4, P30122, A6QQ45
>3 SUPERFAM links 1 more: Q58DG4, P30122, A6QQ45
Sequence
Graphical view for this peptide sequence: bovin-balip
Colored MSA for Cholesterol_esterase (raw)
LGASRLGPSPGCLAVASAAKLGSVYTEGGFVEGVNKKLSLFGDSVDIFKG
IPFAAAPKALEKPERHPGWQGTLKAKSFKKRCLQATLTQDSTYGNEDCLY
LNIWVPQGRKEVSHDLPVMIWIYGGAFLMGASQGANFLSNYLYDGEEIAT
RGNVIVVTFNYRVGPLGFLSTGDSNLPGNYGLWDQHMAIAWVKRNIEAFG
GDPDNITLFGESAGGASVSLQTLSPYNKGLIKRAISQSGVGLCPWAIQQD
PLFWAKRIAEKVGCPVDDTSKMAGCLKITDPRALTLAYKLPLGSTEYPKL
HYLSFVPVIDGDFIPDDPVNLYANAADVDYIAGTNDMDGHLFVGMDVPAI
NSNKQDVTEEDFYKLVSGLTVTKGLRGANATYEVYTEPWAQDSSQETRKK
TMVDLETDILFLIPTKIAVAQHKSHAKSANTYTYLFSQPSRMPIYPKWMG
ADHADDLQYVFGKPFATPLGYRAQDRTVSKAMIAYWTNFARTGDPNTGHS
TVPANWDPYTLEDDNYLEINKQMDSNSMKLHLRTNYLQFWTQTYQALPTV
TSAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

LGASRLGPSPGCLAVASAAKLGSVYTEGGFVEGVNKKLSLFGDSVDIFKG
IPFAAAPKALEKPERHPGWQGTLKAKSFKKRCLQATLTQDSTYGNEDCLY
LNIWVPQGRKEVSHDLPVMIWIYGGAFLMGASQGANFLSNYLYDGEEIAT
RGNVIVVTFNYRVGPLGFLSTGDSNLPGNYGLWDQHMAIAWVKRNIEAFG
GDPDNITLFGESAGGASVSLQTLSPYNKGLIKRAISQSGVGLCPWAIQQD
PLFWAKRIAEKVGCPVDDTSKMAGCLKITDPRALTLAYKLPLGSTEYPKL
HYLSFVPVIDGDFIPDDPVNLYANAADVDYIAGTNDMDGHLFVGMDVPAI
NSNKQDVTEEDFYKLVSGLTVTKGLRGANATYEVYTEPWAQDSSQETRKK
TMVDLETDILFLIPTKIAVAQHKSHAKSANTYTYLFSQPSRMPIYPKWMG
ADHADDLQYVFGKPFATPLGYRAQDRTVSKAMIAYWTNFARTGDPNTGHS
TVPANWDPYTLEDDNYLEINKQMDSNSMKLHLRTNYLQFWTQTYQALPTV
TSAG


References
5 more
    Title: Purification and characterization of bovine pancreatic bile salt-activated lipase
    Tanaka H, Mierau I, Ito F
    Ref: J Biochem, 125:883, 1999 : PubMed

            

    Title: Structure of bovine pancreatic cholesterol esterase at 1.6 A: novel structural features involved in lipase activation
    Chen JC, Miercke LJ, Krucinski J, Starr JR, Saenz G, Wang X, Spilburg CA, Lange LG, Ellsworth JL, Stroud RM
    Ref: Biochemistry, 37:5107, 1998 : PubMed

            

    Title: The crystal structure of bovine bile salt activated lipase: insights into the bile salt activation mechanism
    Wang X, Wang CS, Tang J, Dyda F, Zhang XC
    Ref: Structure, 5:1209, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer