human-APEH

 
Homo sapiens (Human) acylamino acid-releasing enzyme

Comment
Cleavage of an N-acetyl or N-formyl amino acid from the N-terminus of a polypeptide. Preferentially cleaves off Ac-Ala, Ac-Met and Ac-Ser Belongs to peptidase family s9C, Fujino et al Q9P0Y2: P13798 2aa dif with Q9BQ33 old human-acph


Relationship
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic


Inhibitor: AA74-1 , ARI-3099 ,
3 Genbank : D38441, J03068, AC099668
2 UniProt : P13798, C9JIF9
1 Ncbi-nid : 556513
1 Ncbi-pid : 556514
2 UniProtTrembl : P13798, C9JIF9
2 Interpro : P13798, C9JIF9
2 Prodom : P13798, C9JIF9
2 Pfam : P13798, C9JIF9
2 PIRSF : P13798, C9JIF9
2 SUPERFAM : P13798, C9JIF9
2 QuickSwissBlast : P13798, C9JIF9
1 EntrezGene : 327
1 SNP : 327
1 UniGene : 517969
1 HUGO HGNC : 586
1 IUPHAR : 2328
1 OMIM : 102645
1 Ensembl : ENSG00000164062
 
Sequence
Graphical view for this peptide sequence: human-APEH
Colored MSA for ACPH_Peptidase_S9 (raw)
MERQVLLSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGQYRTVHTEW
TQRDLERMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSG
SMKAVLRKAGGTGPGEEKQFLEVWEKNRKLKSFNLSVLEKHGPVYEDDCF
GCLSWSHSETHLLYVAERKRPKAESFFQTKALDVSASDDEIARLKKPDQP
IKGDQFVFYEDWGENMVSKSIPVLCVLDVESGNISVLEGVPENVSPGQAF
WAPGDAGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLIGGKCELLSDDSL
AVSSPRLSPDQCRIVYLQYPSLIPHHQCSQLCLYDWYTKVTSVVVDVVPR
QLGENFSGIYCSLLPLGCWSADSQRVVFDSAQRSRQDLFAVDTQVGTVTS
LTAGGSGGSWKLLTIDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWV
SLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQV
PMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILS
LPGNVGHQDVKDVQFAVEQVLQEEHFDASHVALMGGSHGGFISCHLIGQY
PETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCLPDLSVWAE
MLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLL
LYPKSTHALSEVEVESDSFMNAVLWLRTHLGS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MERQVLLSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGQYRTVHTEW
TQRDLERMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSG
SMKAVLRKAGGTGPGEEKQFLEVWEKNRKLKSFNLSVLEKHGPVYEDDCF
GCLSWSHSETHLLYVAERKRPKAESFFQTKALDVSASDDEIARLKKPDQP
IKGDQFVFYEDWGENMVSKSIPVLCVLDVESGNISVLEGVPENVSPGQAF
WAPGDAGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLIGGKCELLSDDSL
AVSSPRLSPDQCRIVYLQYPSLIPHHQCSQLCLYDWYTKVTSVVVDVVPR
QLGENFSGIYCSLLPLGCWSADSQRVVFDSAQRSRQDLFAVDTQVGTVTS
LTAGGSGGSWKLLTIDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWV
SLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQV
PMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILS
LPGNVGHQDVKDVQFAVEQVLQEEHFDASHVALMGGSHGGFISCHLIGQY
PETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCLPDLSVWAE
MLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLL
LYPKSTHALSEVEVESDSFMNAVLWLRTHLGS

Graphical view for this nucleotide DNA sequence (2434 bp): human-APEH



References
3 more
    Title: Identification of oxidized protein hydrolase of human erythrocytes as acylpeptide hydrolase
    Fujino T, Watanabe K, Beppu M, Kikugawa K, Yasuda H
    Ref: Biochimica & Biophysica Acta, 1478:102, 2000 : PubMed

            

    Title: The nucleotide sequence of human acylamino acid-releasing enzyme
    Mitta M, Ohnogi H, Mizutani S, Sakiyama F, Kato I and
    Ref: DNA Research, 3:31, 1996 : PubMed

            

    Title: The DNF15S2 locus at 3p21 is transcribed in normal lung and small cell lung cancer
    Naylor SL, Marshall A, Hensel C, Martinez PF, Holley B, Sakaguchi AY
    Ref: Genomics, 4:355, 1989 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer